KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_349Help
Entry
BLBBGE_349        CDS       T00995                                 

Gene name
tpx
Definition
(GenBank) peroxiredoxin (thioredoxin peroxidase)
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbl04147]
    BLBBGE_349 (tpx)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     BLBBGE_349 (tpx)
Exosome [BR:bbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   BLBBGE_349 (tpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C Thioredoxin_8
Motif
Other DBs
NCBI-ProteinID: ACY40360
UniProt: D0JB22
Position
347146..347775
Genome map
AA seq 209 aa AA seqDB search
MKTLISKKAPNFTASAVLNGKNIVQNFTLEQFYGKKYVLLFFYPKDFTFVCPTEIYAFQE
KIKDFETRNVQIIAVSTDTEQSHWAWLQMPKEKGGIYGVTYPIVSDINKTISHNYGVLSG
DWILDSNEGLKATGELIAYRGLFLIDKEGIIRHILINDFPLGRNVHEAIRMVDSLQYYEK
SGEVCPANWTIGKKAMKASHSGIVDYFSS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaatttcaaaaaaagcgcctaattttacggcaagtgcggtattaaatgga
aaaaatattgtacaaaattttactttagaacaattttatggaaaaaagtatgttttactt
tttttctatcctaaagattttacttttgtttgtcccacagaaatttatgcatttcaagaa
aaaataaaagattttgagactagaaatgtacaaatcattgctgtatctacggatacagaa
caatctcattgggcttggttacagatgccaaaagaaaaaggtggaatatatggggtcacc
taccctattgtttctgatattaataaaaccatatctcataattatggagttttgtctgga
gattggattttagattctaatgaaggattgaaagcaacgggagaacttattgcttacaga
ggtttatttttaatagataaagaaggtattatacgacatattttaattaatgattttcct
ttaggtagaaatgtacatgaagctattcgtatggtagattctcttcaatattatgaaaaa
agtggagaagtgtgcccagctaattggacaattggaaaaaaagccatgaaggctagtcat
agtggaattgtagattatttttcatcttaa

DBGET integrated database retrieval system