KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_354Help
Entry
BLBBGE_354        CDS       T00995                                 

Gene name
gidB
Definition
(GenBank) glucose-inhibited division protein B
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bbl03009]
    BLBBGE_354 (gidB)
   03036 Chromosome and associated proteins [BR:bbl03036]
    BLBBGE_354 (gidB)
Enzymes [BR:bbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     BLBBGE_354 (gidB)
Ribosome biogenesis [BR:bbl03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BLBBGE_354 (gidB)
Chromosome and associated proteins [BR:bbl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BLBBGE_354 (gidB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GidB Methyltransf_31 Methyltransf_23 Methyltransf_4 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACY40365
UniProt: D0JB27
Position
complement(352463..353083)
Genome map
AA seq 206 aa AA seqDB search
MELYKKYFPDLLNQQLYKLSSLKNLYAYWNTHVNLISRKTFYDFDQQHILFCLGIAKVFS
FFPGSCVMDLGTGGGFPGIPLSIVFPHTEFILVDSIRKKIKIIEKIIYDLHLKNAHPICI
RAEKLENKFDFVVTRAVTKIDIIQNWIKNKFKCKSNSKIQNGVFHLKGGNLSEELKKFPH
AIEYPLNHYFKEPFFITKKVIWISNI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaattatataaaaaatattttccagatttattgaatcaacaactttataagttgtct
tctttaaaaaacttgtacgcatattggaatacacatgtcaatctaatttctagaaagaca
ttttacgattttgatcaacaacatatccttttttgtttaggaatagctaaagtattttct
ttttttcctggatcatgtgttatggatttaggcacaggaggaggatttccgggtattcca
ttatccatagtttttcctcatacagaatttatattggtcgattctattcgaaaaaaaatt
aaaattatagaaaaaatcatatatgatcttcatttaaaaaatgcacatcctatttgtata
cgtgcagaaaaattagaaaataaatttgattttgtggttactagagccgtaacaaaaata
gacatcattcagaattggataaaaaataaatttaaatgcaaatctaattctaaaattcaa
aatggagttttccatctaaaaggaggaaatctttctgaggaattaaaaaaatttcctcat
gcaatagaatatcctttaaatcattattttaaagaaccattttttataactaaaaaagta
atttggatttccaatatttaa

DBGET integrated database retrieval system