KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_364Help
Entry
BLBBGE_364        CDS       T00995                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00220  Arginine biosynthesis
bbl00250  Alanine, aspartate and glutamate metabolism
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLBBGE_364 (argH)
   00220 Arginine biosynthesis
    BLBBGE_364 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbl04147]
    BLBBGE_364 (argH)
Enzymes [BR:bbl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     BLBBGE_364 (argH)
Exosome [BR:bbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLBBGE_364 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACY40373
UniProt: D0JB35
Position
361017..362375
Genome map
AA seq 452 aa AA seqDB search
MKIWEKKTHSSIDKEIENFTSGKDSKIDLLLAPHDVIGTIAHIIMLKSIGLLNQKDLIIL
IQELRHIYVHEILKNNFKMDEGIEDIHSQIEFLLTNRLGEVGKKIHSGRSRNDQILVDLK
LFVRTEIKEIVLIAYSFFDFLLKLSEQHKNTLMPGYTHYQIAMPSSFGLWFSAYAESLID
DLLLVHTAYRIVNKNPLGSAAGYGSSLPLNRKMTTDLLGFENLNYNVIYAQMGRGKMERI
VSESIASLARTLSKMAQDICLYLSQNFNFISFPDHLTTGSSIMPHKKNPDVFEMIRAKCN
RMISLPNEISLISSNLCSGYHRDFQIIKERFLPIFEEIKKCFSMFQYMLNHIIVRKDILK
EEKYKYLFSVEAVNKLVVEEGYSFRDAYQKIGSDIQNGCFKPLTNSFYSHEGSIGNLCNT
KIRNLMQNVIKEFDFYKLDQVIKRLIYSKIHF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatttgggagaaaaagactcattcgagtatagataaagaaatagaaaattttact
tcaggtaaagattctaaaatagatttacttttagctccgcatgatgtaatagggactata
gctcatatcattatgttgaaaagtattggattattaaatcaaaaagatttaataattttg
attcaggagttgcgtcatatttatgttcacgaaatattaaagaataattttaaaatggat
gaaggaatagaagatattcattctcaaatagagtttttattaacaaatcgtttaggagaa
gtaggaaaaaaaatacatagtggtcgatctagaaacgatcaaatattggtggacttgaaa
ctttttgttcgtacagaaatcaaagaaatagttttgattgcttattctttttttgatttt
ttattaaaattaagtgaacaacataaaaatacattaatgcctggttatactcattatcaa
atagctatgccatcttcttttggtctttggttttctgcatatgcagaaagtttgatagat
gatttactgttagttcacacggcatatcgtattgtcaataaaaaccctttaggatctgct
gcgggttatggttcttctttacctttaaatcgaaaaatgacaacggatttattgggattt
gaaaatttaaattataatgtaatatatgctcaaatgggacgtggtaaaatggaaagaatc
gtttcagaatctattgcttcattagcaagaactttaagtaaaatggcacaagatatttgc
ttatatttaagtcaaaatttcaatttcattagttttcctgatcatttgactaccggatct
agcatcatgcctcacaaaaaaaatccagatgtttttgagatgatacgagctaaatgtaat
agaatgatttcattgcctaatgaaatttctttgatttcttctaatttgtgttctggatat
catagagattttcaaattattaaagaaagatttcttcctatttttgaagaaatcaaaaaa
tgtttttctatgtttcagtatatgttgaatcatatcatagtgagaaaggacattcttaag
gaagagaagtataaatacttgtttagtgtagaggcagttaacaaacttgttgttgaagaa
ggatattcttttagagatgcttatcaaaaaataggttcagatatacaaaatggatgtttc
aaacccttgacaaatagtttttattctcatgaaggaagcatagggaatttatgcaacaca
aaaattagaaatttgatgcaaaatgtgataaaagaatttgatttttataaacttgatcaa
gttataaaacgtttaatttatagcaaaattcatttttaa

DBGET integrated database retrieval system