KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_369Help
Entry
BLBBGE_369        CDS       T00995                                 

Definition
(GenBank) putative acyl protein synthetase
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxE MCM_bind IF-2B
Motif
Other DBs
NCBI-ProteinID: ACY40378
UniProt: D0JB40
Position
complement(367465..368427)
Genome map
AA seq 320 aa AA seqDB search
MSFKKKIFSILSKKEFENLALDIFHYQIANNKIYRNYLQLLKIDPMKIKNISKIPFLPIS
FFKTHCIWSSKTSIPDIIFTSSGTTGIKSKHYVADLSVYMNSIRKGFEFFYGPIEKFKFL
GFFPLDRKDSSLIYMVKYFIQKTIQNGSHFIYDYNKNLIIPDQKNIFIFGLSFSLLDFIE
YVGKNGNQENVIVMETGGMKGKRKEIIREELHNLLKKFFCVKEIHSEYGMTELLSQAYAK
KNGVFRCPPWMKIYIRDPEDPMIHIDNNKIGGIDIIDLSNYLSCPFISTEDLGKKINDYE
FEVLGRMDFSDLRGCNIMTI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaagaagattttttcgatattatctaaaaaagaatttgaaaatttagca
ttggatatatttcattatcaaattgcaaataacaaaatttatagaaactatcttcaatta
ttgaagattgatccaatgaaaataaaaaatatttctaaaattccttttttacctatttct
tttttcaaaacacattgtatttggagtagtaaaactagcattccagatatcattttcact
agtagtggaactacaggaataaaaagtaaacattatgtagcagatttaagtgtttatatg
aacagtattagaaaaggatttgaattcttttatggaccaatagaaaaattcaaattttta
ggattttttcctcttgatagaaaggattcttctttaatttacatggtaaaatattttata
caaaaaaccattcaaaatggaagtcattttatttatgactataataaaaatcttattatt
cctgatcaaaaaaatattttcatttttggacttagtttttctttattagatttcatagaa
tatgtgggaaaaaatgggaatcaagaaaacgtgattgttatggaaacaggaggaatgaag
ggaaaaagaaaagaaataattagagaagaattacacaatttattgaaaaaatttttttgt
gtaaaggaaattcactcggaatatggtatgacagaattgctttctcaagcctatgcaaaa
aaaaacggtgtatttcgatgtcctccttggatgaaaatatatataagagatccagaagac
cctatgattcatatagataacaataagataggaggaattgatattatagatttatcgaat
tacttatcttgtccttttatttctactgaagatttaggaaaaaaaataaatgactatgaa
ttcgaagtattaggaagaatggatttttcagatctaagagggtgcaacataatgaccatt
tga

DBGET integrated database retrieval system