KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_372Help
Entry
BLBBGE_372        CDS       T00995                                 

Gene name
pheS
Definition
(GenBank) phenylalanine-tRNA ligase subunit alpha
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00970  Aminoacyl-tRNA biosynthesis
Module
bbl_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLBBGE_372 (pheS)
Enzymes [BR:bbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     BLBBGE_372 (pheS)
Amino acid related enzymes [BR:bbl01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   BLBBGE_372 (pheS)
Transfer RNA biogenesis [BR:bbl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BLBBGE_372 (pheS)
 Prokaryotic Type
    BLBBGE_372 (pheS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N tRNA-synt_2 tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ACY40381
UniProt: D0JB43
Position
369297..370274
Genome map
AA seq 325 aa AA seqDB search
MDQKIDQIKKEIKCFHIKTYNDLETFRIKFLGKKRGILTILFKELKKISIHKRKIYGKII
NELKKEVQKKIFYYKSKNDNEKILKYDPTLPGKSIEIGSIHPLSMIKNRIIDIFLKIGFS
YVDGPEIEDDWHNFTALNIPIFHPSRDMQDTFFLCQSPDILLRTHTSSIQIRYMKKHRPP
FRVLSIGKVYRNETISSRSNFMFHQAEGFYIDKKVSFSDLKQTIHYLITSLFGKEKIRFR
PSYFPFTEPSAEVDIYCNREWLEIMGCGMIDPEVLKNVDIDPEIYSGFAFGVGIERLALM
IYQMKDIRIYFDNDIRFLRQFKNEF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaaatagatcaaataaaaaaagaaatcaaatgttttcatattaaaacatat
aatgatttagaaacatttagaattaaatttttaggaaaaaaaagaggaattctaacaata
ttattcaaagaattaaaaaaaatatccattcataaaagaaaaatttatggaaaaattatt
aatgaattaaaaaaagaagttcaaaaaaaaattttttactacaaatccaaaaatgacaat
gaaaaaatacttaagtacgatccgactcttcctggaaaatctatagaaataggatccatt
catcccctatctatgatcaaaaatagaatcatagatatttttctaaaaattggattttct
tatgtagacggtcctgaaatagaagatgattggcacaattttacggctttaaatattcca
atctttcatccatctagagatatgcaagacacattttttttatgtcaaagtccagatatt
ttgttgcggacacatacttcatctatacaaatacgatacatgaaaaaacatcgtccgcct
tttcgtgttttatctataggaaaagtatatagaaatgaaactatttcatcacgttcaaat
ttcatgtttcatcaagcagaagggttttatatagataaaaaagtttccttctctgattta
aaacaaacgattcattatttaataacttctctttttggaaaagaaaaaatcagatttcgt
ccttcttattttccatttacagaacctagtgctgaagtagatatatattgtaatagagaa
tggttagaaattatgggctgtggaatgatagaccccgaagttttgaaaaatgtagatatt
gatccagaaatttattctggatttgcttttggagtgggaatagaacgtttagctttaatg
atttatcagatgaaagatattagaatttattttgataatgatattcgttttttaagacaa
tttaaaaatgaattttag

DBGET integrated database retrieval system