KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_374Help
Entry
BLBBGE_374        CDS       T00995                                 

Definition
(GenBank) hypothetical protein BLBBGE_374
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ACY40383
UniProt: D0JB45
Position
complement(371036..371365)
Genome map
AA seq 109 aa AA seqDB search
MFIFIRNFLHKKWCILKNEVIQVLISIMTEIFFNFFLLIFCIIIFFLGSLSLCFFLSFYF
GNYVIGFGFLTILYFFLFLFIFFFCRNISRFFIKNLLSKSIFRIFDKKN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgttcatttttattagaaattttctacataaaaaatggtgtattttaaaaaatgaagtt
attcaagtattgatttccatcatgacagagattttttttaatttttttttgttgatattt
tgtattattattttttttttaggaagtctttctttatgtttttttctttccttctatttc
ggcaattatgttatcggatttggatttttaactattttatatttttttctttttcttttt
atcttttttttctgtagaaatatttcacgattttttatcaaaaatttattaagtaaatct
atttttagaatttttgataaaaaaaattaa

DBGET integrated database retrieval system