KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_380Help
Entry
BLBBGE_380        CDS       T00995                                 

Gene name
pnuC
Definition
(GenBank) nicotinamide mononucleotide transporter
  KO
K03811  nicotinamide mononucleotide transporter
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbl02000]
    BLBBGE_380 (pnuC)
Transporters [BR:bbl02000]
 Other Transporters
  Others
   BLBBGE_380 (pnuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMN_transporter PTP_tm
Motif
Other DBs
NCBI-ProteinID: ACY40389
UniProt: D0JB51
Position
375419..376045
Genome map
AA seq 208 aa AA seqDB search
MNDWIDILLSPYSNSNISHIILEFTAVVFTVFSVFFAQNNNIWVYPIGIVSTIIYSYLTF
VTSLYGDFIINLYYTVMSFYGWYVWLHKKDKKNKEIPITFCNQKDYLNTAILFLFTCICS
IMVYHFHGKLKSHSDWMDVLTTGIYFSGMYQMAMKKVENWIFWMIGNGISVPLYFLKGFV
LTGILFIILVLLAIGGFFIWKKKALQIL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattggattgatatccttttatccccctattctaatagcaatatttctcatata
attttagaatttacagctgtagtatttacagtatttagtgttttttttgctcaaaataat
aatatatgggtatatccaataggaatagtaagtactataatatatagttatttaactttt
gttacttctctttacggtgattttattattaatttgtattacacggtgatgagtttttat
ggatggtatgtctggctacataaaaaagataaaaaaaacaaagaaattcctatcactttt
tgcaatcaaaaagattatttaaacacggctattttgtttttatttacctgtatttgcagt
ataatggtttatcattttcatggaaaacttaaatcccattctgattggatggatgtattg
acaacagggatttatttttctggtatgtatcaaatggctatgaaaaaagtagaaaactgg
atattttggatgattggaaacggaatttccgttcctctttattttttgaaaggttttgta
ttgacaggaattttatttatcattcttgttttattggctataggagggttttttatttgg
aaaaaaaaagcacttcaaattttataa

DBGET integrated database retrieval system