KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_381Help
Entry
BLBBGE_381        CDS       T00995                                 

Gene name
hisS
Definition
(GenBank) histidine-tRNA ligase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00970  Aminoacyl-tRNA biosynthesis
Module
bbl_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLBBGE_381 (hisS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbl01007]
    BLBBGE_381 (hisS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbl03016]
    BLBBGE_381 (hisS)
Enzymes [BR:bbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     BLBBGE_381 (hisS)
Amino acid related enzymes [BR:bbl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BLBBGE_381 (hisS)
Transfer RNA biogenesis [BR:bbl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BLBBGE_381 (hisS)
 Prokaryotic Type
    BLBBGE_381 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His HGTP_anticodon tRNA-synt_2b tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: ACY40390
UniProt: D0JB52
Position
complement(376040..377452)
Genome map
AA seq 470 aa AA seqDB search
MESPNIPKGTRDFSSIEMRKRNYLIQTIREKFELFGFFPIETPSFEKISTLIGKYGKEGD
YLMFKLLHSGHVLKKRISDVFRRINNKEKTVDVTKFLTEHISNKALRYDLTVPFVRYVGM
HKNEIVFPFKRYQIQPVWRADKPQKGRFREFYQCDADIISYSWSLWKEIELIQLCDEIFT
KLNFPIIIYINHRDILGGLVEISGIKNNLWKDFTTSLDKWDKIGRDLVKKEMLGKGISSQ
SFEKIAFFFDMKENFYKKEKYLTVAFQYSKKGKKGIKDLSFIYQNIKSISLQNTKLEWNI
SLARGMNYYTGTILEIVPFHNNSSSNSISIGGGGRYDQLANLFGMKNISGVGISLGLDRI
YLAMEKENLLQTISNYPSKVLFINFGDEEVLYAYKMIKFLRKKGISTQLYPHAVQIGKQF
RYANENNIPFTISIGKNEIQRNKIRVKNLKERTEKEYDHINDVVDQLKSL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggagtcacctaatattcccaaagggaccagggatttctcatcaatagagatgaggaaa
cgaaattatttaattcaaactattagagaaaaatttgagctttttggtttttttccgatt
gaaaccccttcttttgaaaagatttctactctgattggaaaatatggaaaagaaggagat
tatttgatgtttaaattacttcattcaggtcatgttttaaaaaaaagaatttcagatgtt
tttagaagaattaataataaggaaaaaacagttgatgttacaaaatttttaactgaacat
atatctaataaagctcttagatatgatttaacggttccttttgttcgttatgtgggaatg
cataaaaatgaaatagtttttccttttaaaagatatcaaattcaacctgtatggcgtgct
gataaacctcaaaaaggtagatttagagaattttatcaatgtgatgcagatattatttca
tattcttggtctttatggaaagaaatagaattaattcaactttgtgacgaaatttttacc
aaactgaattttcctatcatcatctatattaatcatagagatatattaggaggattagtt
gaaatttctggtataaaaaataatttatggaaagattttactacatctttagataaatgg
gataaaattggacgagatttagttaaaaaagaaatgctggggaaagggatttcgtctcaa
tcatttgagaaaatagcattttttttcgatatgaaagaaaatttttataaaaaagaaaaa
tatttaactgtagcttttcaatattctaaaaaaggaaaaaagggaatcaaagatcttagt
tttatttatcaaaatataaaaagtatttctttacaaaacacaaaattggaatggaatatt
tctttagccagaggaatgaattattatacaggtacaatattagaaattgtaccatttcat
aataatagttcttcaaattcgatttctattggtggaggaggaaggtatgatcaattagct
aatttatttggaatgaaaaatatttctggagtaggaatttctttaggtttagatagaatt
tatttagctatggaaaaagaaaatttgttacaaactatttctaattatccttcaaaagtt
ttgtttattaattttggagatgaagaggttttgtatgcgtataaaatgataaaatttttg
agaaaaaaaggaatttccactcagttatatcctcatgctgttcaaatcgggaaacaattt
agatatgctaatgagaataatattccatttactattagtataggaaaaaatgaaattcaa
agaaataaaataagagtaaaaaatcttaaagaaagaacagaaaaagaatacgatcatatc
aatgatgttgtagatcaattaaaatcattataa

DBGET integrated database retrieval system