KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_384Help
Entry
BLBBGE_384        CDS       T00995                                 

Gene name
ftsQ
Definition
(GenBank) cell division protein FtsQ
  KO
K03589  cell division protein FtsQ
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbl03036]
    BLBBGE_384 (ftsQ)
Chromosome and associated proteins [BR:bbl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BLBBGE_384 (ftsQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsQ FtsH_ext
Motif
Other DBs
NCBI-ProteinID: ACY40393
UniProt: D0JB55
Position
complement(380238..380960)
Genome map
AA seq 240 aa AA seqDB search
MKNKFFILILLLYIICMVSLFYFSQKIHKNRNFKQFNIVIDPLSKDHFVNEEIIKNILFS
KVEKIEKKNRSIMYIDNGKKLNNYPFIKRSEVFLSVDGTLNIQVWQKEPILRIKNGNQEY
YLTKDAENLELSPFYSSKVILAKGIFSKKENKYLADLVQFINSDELLKNQIISIKKNDHN
LFILIPKIGNHHIILGNIKNFKNKLNKLKAFYKQYLNKIDINQYKSIDLQYKDQVVAKKR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaattctttatcctgattttattattatatataatttgtatggtatcgctt
ttttatttttctcaaaaaatacataaaaacagaaatttcaaacaattcaatatcgttatt
gatcccttatccaaagatcattttgtaaatgaagaaatcattaaaaatattctattttct
aaagtagaaaaaattgaaaaaaaaaatcggtcaattatgtatattgataatggaaaaaaa
ttaaataattatccttttataaaaagatctgaagtgtttctgagtgtagatggaaccctg
aatattcaagtttggcagaaggaacccattttaagaataaaaaatggaaatcaagaatat
tatctgaccaaagatgcagaaaatttagaactttctcctttttattcgtcaaaagttatt
ttagcaaaagggattttttcaaaaaaagaaaataaatatttagcggacttggtccaattt
ataaactctgatgaactactcaaaaatcaaattattagcatcaaaaaaaatgatcataac
ttatttattttaattccaaaaataggaaatcatcatattatattaggaaatatcaagaat
tttaaaaataaattgaataaattaaaagcattttataagcagtacctaaataaaatagat
attaatcaatataaaagtattgatttgcaatataaagaccaagtagtcgcaaaaaaaaga
taa

DBGET integrated database retrieval system