KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_386Help
Entry
BLBBGE_386        CDS       T00995                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00550  Peptidoglycan biosynthesis
bbl01100  Metabolic pathways
bbl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLBBGE_386 (murG)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BLBBGE_386 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
    BLBBGE_386 (murG)
Enzymes [BR:bbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     BLBBGE_386 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
 Precursor biosynthesis
  Glycosyltransferase
   BLBBGE_386 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_trans_1_3 Phage_endo_I Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACY40395
UniProt: D0JB57
Position
complement(382328..383434)
Genome map
AA seq 368 aa AA seqDB search
MNNNISPRIIIGSGGTGGHIYPGIAIADELKKKIPGTNILFIGSKKHMEMKEIPKFGYSI
EGICISGGKDKFFSIEGFILSIQLIYSFFLVNKIIKKFSPDIVIGTGGFVSFPTLYAAKK
NKIPILIQEQNSFPGLTNRIFSRYAHKVCVAYEQAKKYFPKEKTIITGNPVRSEMFQLPS
KKKACIHLGLKVERPIILSIGGSQGSNSMNNAWIKGLKKLIELDMQLIWQVGKLDIHRMK
KNKMSHHSNFILMDFIENIPICYAAADIIVSRAGALTISEICLIGKPYILIPFPWSSDDH
QNKNARILEEKEAALIIKNEEIEQRLVDSTIQLVNDSRMKKKMSQNILQLGKPRATNDIV
NEILQIIL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataatatttcacctagaataattattggaagtggagggactggtggacatata
tatccgggaatagctattgcagacgaactgaaaaaaaaaattccaggaaccaatatttta
tttattggatctaaaaagcatatggaaatgaaagaaattcctaagtttggatattctata
gaaggaatttgtatttcaggaggaaaagataaatttttttctatagaaggcttcatttta
tctatacaattgatatatagttttttcttggtaaataaaattatcaaaaaattttctcca
gacatagttattggaacaggaggatttgtaagttttcctactttatatgcagccaaaaaa
aataaaatccctattctcattcaagaacaaaattcttttcctggattaactaatagaata
ttttctcgttatgcacataaagtatgtgttgcttatgagcaagcaaagaaatattttcca
aaagaaaaaaccataataactggaaatccagttagatctgaaatgttccaattacctagt
aaaaaaaaagcttgtattcacttaggattaaaggtggaaagacctattattttatctata
gggggaagccaaggttccaatagtatgaataatgcttggataaaaggtttaaaaaagcta
atagaattagatatgcaacttatttggcaagttggtaaattagatattcatagaatgaaa
aaaaataaaatgtctcatcattcaaattttattttaatggattttattgaaaacatcccg
atatgttatgctgctgcagatatcatcgtgtctagagctggagctttaactatatcagaa
atatgtttaataggaaaaccatacatattaattcctttcccttggtcttccgatgatcat
caaaataaaaatgctagaatattagaagaaaaagaggcggctttaattattaaaaatgaa
gagatagagcaaagattagtggattcaactatacaattagttaatgattccagaatgaaa
aaaaaaatgagtcaaaatattctgcaattaggaaaacctagagctacaaatgatattgtc
aatgagattttacaaattattttatga

DBGET integrated database retrieval system