KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_389Help
Entry
BLBBGE_389        CDS       T00995                                 

Gene name
mraY
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00550  Peptidoglycan biosynthesis
bbl01100  Metabolic pathways
bbl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLBBGE_389 (mraY)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BLBBGE_389 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
    BLBBGE_389 (mraY)
Enzymes [BR:bbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     BLBBGE_389 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
 Precursor biosynthesis
  Glycosyltransferase
   BLBBGE_389 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1
Motif
Other DBs
NCBI-ProteinID: ACY40398
UniProt: D0JB60
Position
complement(386006..387094)
Genome map
AA seq 362 aa AA seqDB search
MVFYKKIICWNHRKKNSIGEHIRNLGLIGQKEKEGIPTMGGIVMIFSTLIPTILFSSLKN
IYVIILIITMLHMGFLGFLDDYIKIKYNKKGLSIMGKILGQILLGLLIGSTMYFFNTNVS
IQKIDSNLLEKKEHGFKTTIPIPIFSSHKNEFDYAYLLSWYNKKWKKYTWIVFIPIVILI
MTFLSNGANLTDGIDGLTAGISSIIFATLSLLSIISSNKIYSSHLHFIYIPHLDEILIFS
FSFLGALISFLWYNTYPAQIFMGDTGSLTLGGVIATLAIINRKELILPILCGIFFIENIS
VIIQVLYFRYSKKKYGIGKRIFLMAPLHHHFQKLGYHENKIFNRFIIIQMMLSMLVLILL
II
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttggttttttataaaaagattatatgttggaatcatagaaaaaaaaatagcataggagaa
catatacgaaatcttggacttattggacaaaaagaaaaagaaggaattccaacgatggga
ggaattgtaatgatattttccacattaattcctacaattcttttctcttctttgaagaat
atatatgtaattattttgattatcacaatgttacatatggggtttcttggatttttagat
gattacattaaaataaaatataacaaaaaaggacttagtataatgggaaaaatattaggt
cagattctattagggcttttaattggaagcactatgtatttttttaatacaaatgtttct
attcaaaaaatagattccaatttattggaaaaaaaagaacatggattcaagaccactatt
cctattcccattttttctagtcataaaaatgaatttgattatgcttatcttttaagctgg
tataataaaaaatggaaaaaatatacatggatcgtttttatccctatagtgattttaatt
atgacatttttatccaacggagcgaatctaaccgatggaatagacggattgacagctgga
atttcctctattatttttgctactttatctttattatctatcatatccagtaataaaata
tattcatctcatcttcattttatatatattcctcatttagatgaaatcctcatattttct
ttttcttttttaggagctttaataagctttctttggtacaatacctatccagctcaaatt
ttcatgggagatactggtagcttgactttaggaggagttatagcgactctagctattata
aataggaaagaattgatattacctattttatgtggaattttttttatagaaaatatttct
gtcataatacaagtattgtattttagatattctaaaaaaaaatatggtataggaaaaaga
atttttctcatggctcctttgcatcatcattttcaaaaattaggatatcatgaaaataaa
attttcaatcgttttatcatcatacaaatgatgctttctatgttggtattgattttatta
attatataa

DBGET integrated database retrieval system