KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_401Help
Entry
BLBBGE_401        CDS       T00995                                 

Definition
(GenBank) OmpA/MotB domain-containing protein
Organism
bbl  Blattabacterium Bge (Blattella germanica)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA OMP_b-brl TSP_3
Motif
Other DBs
NCBI-ProteinID: ACY40410
UniProt: D0JB72
Position
complement(399665..400906)
Genome map
AA seq 413 aa AA seqDB search
MKNVNFFIIALFAFFSSIFSHVFSQDSKEKEKWSVRIGAHDINYFPIKSPLKGFFLKKNN
SFNPIISHVELEHKIKKHIGLYLDASLGMVDNNRWRIANGFFVKLSHGVNLYIFPHYKFD
PYLRLGAGYHKFNGYVNRELRISDTKYFKTNKKNFFVLDGGLGFNFWIVSNLGVNLQSTY
NQVFAYQSGDFLNFWKHNVGVIFRFGNLKITENQKYNKNQENKKIVEIDKNHSYYSSENK
EKKEEEKICCQNQNPKDSDKDGVLDQEDLCPNQFGLRKFKGCPDTDSDNVPDYEDKCPKK
FGKKENQGCPDVVFSPILFDLGKFALTPRSLSIVNEIAEIIINSLPNSKFYIDGYTDSHG
KLSYNKTLSLKRANSVFEALISKGVDSSRIEVRGLVGGKYKKKGRRVEITIRK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtcaatttttttattattgctttattcgcttttttttcgtctatattctct
catgttttttctcaagattcgaaagaaaaagaaaaatggtctgttagaataggagcacac
gatataaattattttccgataaaatctcctttaaaaggtttttttcttaaaaagaataat
agttttaatcctattatttctcatgtagaattagagcacaagatcaaaaaacatataggg
ttatatttagatgcatcattaggaatggtcgataataacaggtggagaatagcgaatggt
ttttttgttaaactgagtcatggggtgaatttatatatttttcctcattataagtttgat
ccctatttgcgattaggagcaggttatcataaatttaacggatacgtaaacagagaattg
agaatttcagatacaaaatattttaaaacaaataagaagaatttttttgtattagacggt
ggattaggtttcaatttttggatcgtttctaatttgggggttaacctgcaaagtacttat
aatcaagtatttgcatatcaatcaggagattttttgaatttttggaaacataatgtagga
gttatttttcgttttggtaatttaaaaattacagaaaatcaaaaatataacaaaaatcaa
gaaaacaaaaaaatagtagaaatagataaaaatcattcttattattcttcagaaaataaa
gaaaaaaaagaagaagaaaaaatttgttgccaaaatcaaaatccaaaagattctgataaa
gatggagttttagatcaagaagatttatgccccaatcaatttggattaagaaaattcaaa
ggttgtcccgacacagattcagataacgttccggattacgaagataagtgtcctaaaaaa
tttggaaaaaaagaaaatcaaggatgtcctgatgtagtttttagccctattttatttgat
ttgggtaaatttgcattaactcctcgttctttatcaattgtgaatgaaatagctgaaatc
ataatcaatagtctacctaattccaaattttatatagatggatatacagattctcatgga
aaactttcttataataaaactttatctctaaaaagagcaaactcagtatttgaggctttg
atttctaaaggagtagattcttctagaatagaagttagaggattggtaggaggaaaatat
aagaaaaagggacgacgagtagaaatcacaatacgaaaataa

DBGET integrated database retrieval system