KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_402Help
Entry
BLBBGE_402        CDS       T00995                                 

Gene name
smpB
Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
bbl  Blattabacterium Bge (Blattella germanica)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACY40411
UniProt: D0JB73
Position
complement(400963..401412)
Genome map
AA seq 149 aa AA seqDB search
MSILNRKARFQYHFLEYYVAGIQLFGTEVKSVRQNKVNIVDSFCQMQNGELYSIGMYIAE
YKFGTNWNHSSRRQRKLLLNKKELKKINKKLKDTGLTIVPIELFFNDKGYVKMKIVLAKG
KKTYDKRESLRKRDSLREIKQSLKIKDCI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctaaatagaaaggctagatttcaatatcattttttagaatattatgtagct
ggtatccaattgtttggaacagaagtaaaatccgttagacaaaacaaagttaatattgtg
gatagtttttgtcaaatgcaaaatggagaattgtattctattggaatgtacatagctgag
tacaaattcggaaccaattggaatcattcaagcagaagacaaaggaaattattattgaat
aaaaaagaattaaaaaaaatcaataaaaaattgaaagatacagggttaactatcgttccc
attgaattattttttaacgataaaggatacgtaaaaatgaaaatagttttagctaaagga
aaaaaaacatatgataaacgtgaatctttgcgaaaaagagattctttgagagaaatcaaa
caatctttaaaaattaaagattgtatttaa

DBGET integrated database retrieval system