KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_407Help
Entry
BLBBGE_407        CDS       T00995                                 

Definition
(GenBank) NLP/P60 family protein
Organism
bbl  Blattabacterium Bge (Blattella germanica)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 CHAP Peptidase_C92 DUF1460
Motif
Other DBs
NCBI-ProteinID: ACY40416
UniProt: D0JB78
Position
complement(404917..405267)
Genome map
AA seq 116 aa AA seqDB search
MFTPYRYGGKTKTGIDCSAFIKNVFASYKISLPRISYHQAKKGFFVPKEQIEKGDLLFFA
TGTSKKINHVGMVIHVSPNNIFFIHASTSNGVIISQLYQKYWNHRFIMARRILYSS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgttcactccatatagatatggaggaaaaactaaaacaggaattgattgttctgctttt
ataaaaaacgtttttgcttcttacaaaatatctttaccacgaatttcttatcatcaagct
aaaaaaggtttttttgttcctaaagaacaaatagaaaaaggagatctattattttttgca
acaggaacatctaaaaaaataaatcatgtaggaatggttattcatgtgagtcccaataat
atatttttcattcatgcttctacatctaatggagtaattatatctcaattatatcaaaaa
tactggaatcatagatttattatggcaagaagaattctttattcctcataa

DBGET integrated database retrieval system