KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_409Help
Entry
BLBBGE_409        CDS       T00995                                 

Gene name
rpsT
Definition
(GenBank) 30S ribosomal protein S20
  KO
K02968  small subunit ribosomal protein S20
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl03010  Ribosome
Module
bbl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BLBBGE_409 (rpsT)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    BLBBGE_409 (rpsT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p
Motif
Other DBs
NCBI-ProteinID: ACY40417
UniProt: D0JB79
Position
405688..405927
Genome map
AA seq 79 aa AA seqDB search
MANHLSSLKRIRQNRTKRLRNKYVYKSTKTAIKKLLKEKNKEKYSIVISMIDKLAKKNII
HGNKAARLKKQLNKKLFSN
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcatttatcttctttgaaaagaattagacaaaatcgtactaaacgtttacgt
aacaaatatgtatataagagtacaaaaacagccataaaaaaattattaaaggaaaaaaat
aaggaaaaatattctattgtaatttctatgatagataaattagctaagaaaaatattata
catggaaataaagcggctagattgaaaaaacaattaaataaaaaattattctctaattga

DBGET integrated database retrieval system