KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_409Help
Entry
BLBBGE_409        CDS       T00995                                 

Gene name
rpsT
Definition
(GenBank) 30S ribosomal protein S20
  KO
K02968  small subunit ribosomal protein S20
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl03010  Ribosome
Module
bbl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLBBGE_409 (rpsT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bbl03011]
    BLBBGE_409 (rpsT)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    BLBBGE_409 (rpsT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p Phage_antitermQ
Motif
Other DBs
NCBI-ProteinID: ACY40417
UniProt: D0JB79
Position
405688..405927
Genome map
AA seq 79 aa AA seqDB search
MANHLSSLKRIRQNRTKRLRNKYVYKSTKTAIKKLLKEKNKEKYSIVISMIDKLAKKNII
HGNKAARLKKQLNKKLFSN
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcatttatcttctttgaaaagaattagacaaaatcgtactaaacgtttacgt
aacaaatatgtatataagagtacaaaaacagccataaaaaaattattaaaggaaaaaaat
aaggaaaaatattctattgtaatttctatgatagataaattagctaagaaaaatattata
catggaaataaagcggctagattgaaaaaacaattaaataaaaaattattctctaattga

DBGET integrated database retrieval system