KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_411Help
Entry
BLBBGE_411        CDS       T00995                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00471  D-Glutamine and D-glutamate metabolism
bbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BLBBGE_411 (murI)
Enzymes [BR:bbl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BLBBGE_411 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
 Precursor biosynthesis
  Racemase
   BLBBGE_411 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ACY40419
UniProt: D0JB81
Position
406358..407167
Genome map
AA seq 269 aa AA seqDB search
MKISPLSPIGIFDSGIGGLLIAKEIKIQMPNEDLIYFGDTRNMPYGEKSKEFIIENSMKI
ASFLYKKKCKALVIACNSITSNALDILCKTFHRKILIFNVIDPIVKHKILLSSKRIGIIA
TPATIRSNFYTKEIKKYYHHLDIVQISTSLLAPMIEKGFKIKKNIINNYLNRLKSIDTLL
LACTHYLFLKQEIDNFYHGKVRLIDIQKIVVQEIKKTLNDDKLLCNHPTWNRKFPIFYTS
SLIPTFFEKQVRILFGKKVFIKTHVFNFS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagtccactttctccaataggaatatttgattctggaattggcggactgctt
atagctaaagaaatcaaaattcagatgcctaatgaagatttgatttattttggagatact
agaaatatgccttatggagaaaaatctaaagaatttattatagaaaattctatgaaaata
gcttcttttctttataaaaaaaaatgcaaagctttagttatagcgtgtaattccattaca
tccaatgcgttagatattctttgtaaaacattccatagaaaaatattaatatttaatgta
atagatcctatagtgaaacataaaatacttctttcttccaaaagaataggaataattgct
acacctgctacaatacgttcaaatttttatacaaaagaaatcaaaaaatattatcatcat
ttagatatagttcaaatatctacatctttattagctccaatgattgaaaaaggttttaaa
ataaaaaaaaatattatcaataattatttaaatcgtttaaaatcaatagatacactttta
cttgcctgtactcattatctatttcttaaacaagaaatagataatttttatcatggaaaa
gttcgtttaattgatatacaaaaaatagtagtacaagaaataaaaaaaacattaaatgat
gataaattattgtgtaatcatccaacctggaatagaaaattccctattttttatacatct
agtttgatccctactttttttgagaaacaagttagaattctttttggaaaaaaagtattt
attaaaacacacgtttttaatttttcctaa

DBGET integrated database retrieval system