KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_412Help
Entry
BLBBGE_412        CDS       T00995                                 

Gene name
maeB
Definition
(GenBank) bifunctional malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)/phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00620  Pyruvate metabolism
bbl01100  Metabolic pathways
bbl01120  Microbial metabolism in diverse environments
bbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLBBGE_412 (maeB)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BLBBGE_412 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ACY40420
UniProt: D0JB82
Position
complement(407154..409436)
Genome map
AA seq 760 aa AA seqDB search
MIKNISKFREESLNYHSQFPSGKIQITPTKKYSSQRDLSLAYSPGVAEPCKEIARSSQEV
YKYTSKGNLVAVITNGSAVLGLGDIGALASKPVMEGKALLFKIFSGIDVFDIEIDESDPE
KFIETVKAIAPTFGGINLEDIKAPEAFEIERRLKKELSIPVMHDDQHGTAIISGAALLNA
ITYVGKKIHEIKMVVNGAGAAAISCTRTYKQLGVKPENILMFDSKGLLHSSRTDLNKEKK
EFSVNTYPVPKLDQAIENADVFIGLSIGGILTPNMLKSMGKNPIVFAMANPDPEIDYNLA
IQVRPDIIMATGRSDYPNQVNNVLGFPYIFRGALDVHASVINDEMKLAAVHAIASLAKEP
VPEQVNIVYNKKNISFGKEYIIPKPFDNRLITRVAPAVAKAAMDSGVARNPILDWKIYQE
KLLDRMGYESKMLRMIQNRARTNPKKVVFCNGEEYDILKSVQILHEEGIVSVPVVLGNED
RIKRLINENNLDVELEIVDPEKEENREKVRKFLLQILWERRNRKGLTLYDSKIRMRTNDH
FGAMMVDQGEADAVITGYSRSFSLSLRPMLEVIGRADSVHKTAGMMILLTKRGPLFLADT
AVIPDPTSEELARIALMASHVVKAFDIEPHIAMLSFQNFSSNSKTSSKVSQTVAFLHKKY
PNLIVDGELQPDFALNEFLLASKFPFSKLVKKRANIFIFPNLESGNLTYKFIRGLGNVQT
IGPVMLGMRKPAHVMQMQSSIEEIVNLATLSVIDAQIRKN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacataagtaaatttcgtgaagaatctttaaattatcatagtcaatttcct
tctggaaaaatacaaataacacccactaaaaaatatagtagtcaaagagatctatctctt
gcttattctccaggagtagcagaaccttgtaaagaaatagctcgttcttctcaagaagta
tataaatatacatctaaaggaaatcttgtcgcagtcattactaatggatctgctgtatta
ggtcttggagatattggagcattagcctctaaaccggtaatggaaggaaaagctctttta
ttcaaaattttttctgggattgatgttttcgatatagaaatagacgaatctgatccagaa
aaatttatagaaacagtcaaagctattgcccctacttttggaggaatcaatctagaagat
ataaaagctccagaagcttttgaaatagaaagaagacttaaaaaagaactaagtattcct
gttatgcatgatgatcaacatggaacagcgattatctcaggagctgcattgcttaatgct
atcacctatgttggaaaaaaaattcatgaaattaaaatggtagttaatggggcaggagct
gctgccatttcctgtacaagaacttataaacaacttggcgtaaaacctgaaaatattctc
atgtttgacagcaaagggttattgcattcttcaagaaccgatttgaataaagaaaaaaag
gaattttctgtaaatacttatcctgttccaaaattagatcaagctatcgaaaacgcggat
gttttcattggtttatctataggaggtatattaactcctaatatgttaaaaagtatggga
aaaaatccgattgtgtttgctatggcaaacccagatccagaaatagattataacttagca
attcaagtccgtccagatattattatggctactggaagaagtgattatccaaaccaagtt
aacaatgttttaggatttccttatatttttagaggagctctagatgttcatgctagtgta
attaatgatgaaatgaaattagcagctgtacatgctatagcttctttggcaaaagaacct
gttccagaacaggtcaatattgtttataataaaaaaaatatttcttttggaaaagaatat
attattccaaagccttttgataatcgtttgattactcgtgttgctcctgctgtagctaaa
gccgctatggattctggagtagcgagaaatcctattttagattggaaaatctatcaagaa
aaattgcttgataggatgggttacgaaagtaaaatgcttcgaatgatccaaaatagagca
cgtacaaatcctaaaaaagttgttttttgtaatggagaagaatatgatatattgaaatct
gttcaaattcttcatgaggaaggaattgtttctgttcccgttgttttaggaaatgaagat
cgtatcaaacgtttaatcaatgaaaataacctagatgttgaattagaaattgtagatcca
gaaaaagaagaaaatagagaaaaagtaagaaaatttttacttcaaatcctttgggaaaga
agaaaccggaaaggtttgactttatacgattcaaaaatacgtatgcgtacaaatgatcat
tttggggcaatgatggtagatcaaggagaggcagatgcggttattacaggatattcaaga
agtttttcattgagtttacgtcctatgttagaagttataggtagagcagattccgttcac
aaaacagcaggaatgatgattttattgacaaaacgtggtcccttgtttttggctgataca
gccgtcattccagatccaacaagtgaagaattagctagaatagctttaatggcatctcat
gtagtgaaagcttttgatattgaaccacatatagcaatgttatcttttcaaaatttttca
tctaattcaaaaacatcttctaaggtatctcagacagtagcttttttacataaaaaatat
ccaaatttaatagtcgatggagaattacaacctgattttgctctaaatgaatttttatta
gctagcaagtttcctttttccaaacttgtcaaaaaaagagcaaatatttttatatttcca
aatctagaatcaggaaatttaacttataaatttattagaggattaggaaatgttcaaaca
attggccctgtaatgttaggaatgcgaaaaccggcacatgttatgcaaatgcaatccagt
atagaagaaatagttaatttagcgactttatctgtaatagatgcacaaattaggaaaaat
taa

DBGET integrated database retrieval system