KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_416Help
Entry
BLBBGE_416        CDS       T00995                                 

Definition
(GenBank) cbb3-type cytochrome c oxidase subunit I + II
  KO
K15862  cytochrome c oxidase cbb3-type subunit I/II [EC:1.9.3.1]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00190  Oxidative phosphorylation
bbl01100  Metabolic pathways
bbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BLBBGE_416
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLBBGE_416
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     BLBBGE_416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX1 FixO Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ACY40424
UniProt: D0JB86
Position
complement(411100..413295)
Genome map
AA seq 731 aa AA seqDB search
MKLNTSYYYNNRIVKAFLYATMFWAFIGFLAGLFVALLLFYPDIPELIFGNKLKDTQGIM
GFGRWRMLHTSTAVFAFVGNIIFTGYYYALQRLLKTRVFSDTLSWIHFWGWQIFIFSTWI
TFLLGINTSKEYAEHEWPIDIGIFFIWIVYGINMIGTILKRRIKHLYVSIWFLLGTWVAV
AMLHLFNNLELPISLLSFKSYSIYAGVQDALMQWWYGHNAVAFILTTPILGLMYYFVPKA
SNQPIFSYKLSIIHFWSLIFVYIWAGPHHLMYTSLPNWAQMLGTIFSIMLIAPSWGGMLN
GLLTLRGDWNQVKKNPILKFFVVGITCYGMATFEGPMLATKTLNSIGHFTDWIIAHVHLG
TLGWNGFMAFGVIYWLTQKMWNTKLYSISLANIHFWLGVLGIVLYIFPMYFGSILQSMMW
KKFNPDGTLAYKNFLDSVLSIIPFYKIRFIGGMIYFLGFVLMIFNIFKTIQKGYSIDNEK
FKCDPFYGENIKEKNEKFHSWLERKPIQLTVLSFIAVAIGGFIEIIPTLVIKSNVPTIHN
VKPYKALELEGRDLFVREGCNACHSAQVRPFRDEVVRYGEYSKAGEFVYDHPFLWGSKRT
GPDLAREGGKNPNSWHYNHMYNPRSTSPGSIMPRYPWLIYNKLDRSNTEKKIKAMIKLGV
PYTLKDIKNVNQDMDRQANKIVSDIYKEFPSLEIEMNRQKKVEKEKFIPLDKREIIALIA
YLQRIGTDIKS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatacatcatattattacaataaccgtattgtaaaagcttttctatacgct
actatgttttgggcttttattggatttttagccggattatttgtagccttgttgttgttt
tatcctgatattcctgaattgatttttggaaacaaactgaaggatactcaagggattatg
gggtttggtcgatggagaatgctacatacaagtactgctgttttcgcttttgttggaaat
ataatttttacaggatattactatgctttgcaacgtttattaaagactagagtttttagt
gatactcttagttggattcatttttggggatggcaaatatttattttttccacttggatt
acttttttattaggaattaacactagtaaagagtatgcagaacatgagtggcctatagat
atagggatcttttttatttggattgtttatggaattaatatgataggaactattttaaaa
agaagaatcaaacatttatatgtcagtatttggtttttgttaggaacatgggttgctgta
gcgatgttgcatttatttaacaatcttgagttacctatatctcttttatcttttaagagt
tattctatatatgctggagtacaagatgctttaatgcaatggtggtatggacataatgct
gttgcatttattttgactacccctatactaggattgatgtattattttgtccctaaagca
tctaatcagcctattttttcttataaactttctattattcatttttggtccttaatattt
gtatatatatgggctggtcctcatcatttaatgtatacatctcttcccaattgggctcaa
atgttaggaactattttttcaatcatgttaattgctccttcttggggtggaatgttgaat
ggattacttacattaagaggagattggaatcaagttaaaaaaaatcctattttgaaattt
tttgtagtgggaattacttgttatggaatggctacttttgaaggaccgatgcttgctact
aaaactttgaattctattggacattttacagattggattatagctcatgttcatttagga
actttaggatggaacgggtttatggcttttggagttatatattggcttacacaaaaaatg
tggaatactaaattatactctatatcattagctaatatccatttttggttaggtgtttta
ggaattgtattgtacatttttccaatgtattttggatctatattacaatctatgatgtgg
aaaaaattcaatcctgatggaactttagcttataaaaattttttagattcagtattatcc
atcattccattttataaaataagatttataggtggtatgatttattttttaggttttgtt
ttaatgatttttaatatttttaaaacgattcaaaaaggttattcaattgataatgagaaa
ttcaaatgcgatccattttatggagaaaatataaaagagaaaaatgaaaagtttcacagt
tggttagaaagaaaaccaatacaattaacagttctttcctttatcgcagtagctattgga
ggatttatagaaatcattcctactttagtgattaaatctaatgttcctactattcataat
gtaaaaccttataaggcgcttgaattggaagggagagatttatttgttagagaagggtgt
aatgcttgtcatagtgcacaagtccgtccatttagagatgaggttgttcgttatggagaa
tattctaaagcaggagagtttgtatatgatcatccatttctttggggatctaaacgaaca
ggaccagatttagccagagaaggagggaaaaatcctaattcttggcattataatcatatg
tataaccctagatctacttcacctggatccattatgccaagatatccttggttaatttat
aataaattggataggtctaatacagaaaaaaaaataaaagcaatgatcaaattaggagtt
ccatatactttaaaagatataaaaaatgtaaatcaagatatggatcgtcaagcaaataaa
attgtatctgacatatataaagagtttccaagtttggaaatagaaatgaatcgacaaaaa
aaagtggaaaaagaaaaatttatccctttagataaaagagaaattatagctcttattgct
tatttacaaaggattggaacagatattaaatcttaa

DBGET integrated database retrieval system