KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_421Help
Entry
BLBBGE_421        CDS       T00995                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
bbl02024  Quorum sensing
Module
bbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_421 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BLBBGE_421 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BLBBGE_421 (trpE)
Enzymes [BR:bbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BLBBGE_421 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACY40429
UniProt: D0JB91
Position
418893..420302
Genome map
AA seq 469 aa AA seqDB search
MFKFNFRTIQKKILADSTTPIELYLKLRDIFPNTLLLEFSDYQIFKNNSSILCINPISEL
ILDKNVLRISYPNCVHKHIFINDRLDIQILIEDFFKKFENENTSIFYSGLYGYISYDSIQ
YFENIQFHTPIKEIYNIPQMRFGFYKNLIVFRHFHNEIHLIEHQFINAEETTYINQLIEL
IKKKNFPSFPFKSVGSRSSNVTDIEYKKMVSQGIKACLRGDVFQIVLSRQFQQKFTGDEF
NVYRALRFINPSPYLFYFDYGNYKLFGSSPESQLIIDDKIAYINPIAGTIRRSGNKDKDK
KLSENLSENPKENAEHVMLVDLARNDLSKNSSNVKVEVFKEIQVFSHVLHMVSKVSGKLE
EDISIIKVFGDTFPAGTLSGAPKYKAMELIDKIENQHRGVYGGAIGFFGLNNSCINTAIV
IRSFVSKNNTLFFQAGAGIVSDSKEEKELEEVNNKLMALFKAIELAKNI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaattttagaactattcagaaaaaaattttagctgatagtactacacca
atagaattatatttaaaactaagagatatatttccaaatacattattattagaattttct
gactatcaaattttcaaaaataattcttcgattctttgcattaatccaatttcggaactt
attctagataaaaatgtattacgaatatcatatccaaattgtgttcataaacatattttc
atcaatgatcgattggacatacaaattttaattgaggatttttttaagaaatttgaaaat
gaaaatacttctattttttattccggattatacggatatatatcttatgacagtattcaa
tattttgaaaatattcaatttcatactccaattaaagaaatatacaatattccgcaaatg
cggtttggtttttataaaaatctaattgtatttcgtcattttcacaatgaaattcatttg
atagaacatcaattcattaatgcagaggaaacaacttatattaatcaattgatagaatta
ataaaaaagaaaaattttccttcttttccatttaaatctgtaggaagtcgttcttcaaat
gttacggatatagaatataaaaaaatggtatctcaaggaatcaaagcttgtttacgagga
gatgtttttcaaatagtattatctagacagtttcaacaaaaatttacaggagatgaattt
aatgtatatcgtgctttacgatttatcaatccttctccatatcttttttattttgattat
ggaaactataaattatttggttcttctccagaatcccaattgattattgatgataaaata
gcttacatcaatccaatagcaggaactatacgaagatcgggaaataaagataaggataaa
aaattatctgaaaacctttctgagaatccaaaagaaaatgcagaacacgtcatgttagta
gatttagcaagaaatgatttgagtaaaaattcttccaatgtaaaagtagaagtcttcaaa
gaaattcaagttttttctcatgtactgcatatggtatccaaagtttctggaaaattggaa
gaagacatatcgattataaaagtgtttggagatacttttccagcaggaactttatcagga
gctcctaagtataaagcaatggagttgatagataaaatagaaaatcaacatagaggagtt
tatggaggagctattggtttttttggattgaataattcttgtatcaataccgctatagtt
attcgttcttttgtgagtaaaaataatactcttttttttcaagctggcgcaggaattgtt
tctgattctaaagaagaaaaagagttagaagaagtaaataataagcttatggccttattt
aaagctatagagttagctaaaaatatatga

DBGET integrated database retrieval system