KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_424Help
Entry
BLBBGE_424        CDS       T00995                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Module
bbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_424 (trpC)
Enzymes [BR:bbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BLBBGE_424 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ACY40432
UniProt: D0JB94
Position
421887..422672
Genome map
AA seq 261 aa AA seqDB search
MNILEKIVSVKQKEVSRNRVIRPIKELEKSLFFKRNIFSLVKRLKDSKTGIIAEFKSKSP
SKGVINNFVSVEKVAKDYESSGVCGISILTDQNFFSGKNEDLEKSRSIVSIPILRKDFII
DEYQIIESKSVGADVILLIASILSKNQIKNFSKLAKSIDLETIIEIHNEFEIDKITENLD
IIGINNRNLQTFIVDYNNCLKLSSKIPNNYTKIAESGINDVNHIFELRKQGFKGFLIGEY
FMKRKDPGEFCKKFIKSLLSL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgaaaaaatagtatctgttaaacaaaaagaagtctccagaaacagagtt
attcgtcctataaaagaattggaaaagagtctcttttttaaaagaaacattttttcttta
gtgaaaagactaaaggatagcaaaactggtataattgcagaatttaagtcaaaatcgcct
tctaaaggagttatcaataattttgtttcagtagaaaaagttgccaaggattatgaatct
tcaggggtttgtggaatatctattcttacagatcagaattttttttctggtaaaaatgaa
gatttagaaaaatcacgttctatagtttctatccctatactaagaaaagattttattata
gatgaatatcaaattatagaatctaaatctgtaggagctgatgtgatattgttgattgct
agtattctttctaaaaatcaaataaaaaacttttcaaagttagcaaaaagtattgattta
gaaactattattgaaatccacaatgaatttgaaatcgataaaataacagagaatttagat
attataggaattaacaatcgaaatttgcaaacttttattgtagattataataattgtttg
aaattatcttcaaaaattcctaacaattatacaaagatagccgaaagtggaataaatgat
gtaaatcatatttttgaattaagaaaacaagggtttaaaggctttttaattggagaatat
tttatgaaaagaaaagatcctggagaattttgtaaaaaatttataaaatctttattgtca
ttatga

DBGET integrated database retrieval system