KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_570Help
Entry
BLBBGE_570        CDS       T00995                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00790  Folate biosynthesis
bbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLBBGE_570 (folE)
Enzymes [BR:bbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BLBBGE_570 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF MTTB
Motif
Other DBs
NCBI-ProteinID: ACY40570
UniProt: D0JBN2
Position
complement(568170..568856)
Genome map
AA seq 228 aa AA seqDB search
MMKEKQKKILKNTDQNYILNNNNLVNSKSISQKNNFLMNDEEKIEKIEEHFFQIMETLGL
DMNDDSLRRTPKRVAKMFIQEIFSGLNPKNTPTLSIFDNKYKYNQMLIEKNITVYSTCEH
HFLPIVGKAHVGYISNGKVIGLSKINRIVNFYAKRPQVQERLTMQIVESLQKMLKTQDVA
CVIKAKHLCVNSRGIRDIDSSTVTTELVGSFKKNSEIRREFLHHIGIS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaaaaacagaaaaaaattttaaaaaacactgatcaaaattatattttgaat
aataataatttagtcaatagtaaaagtatttcacaaaaaaataattttttgatgaatgat
gaagaaaaaattgaaaaaatagaagaacattttttccagattatggaaacattaggttta
gatatgaatgatgatagtttacgtcgcactcccaaacgtgtggctaaaatgtttattcaa
gaaatatttagtggtcttaaccctaaaaatactccgaccctttctatttttgataataaa
tataaatacaatcaaatgttgatagaaaaaaatataacagtttactcgacttgtgaacat
cattttcttcctattgtcggaaaagctcatgttggttatatttctaatggaaaggttatt
ggactttctaaaattaatagaattgtgaatttttatgcaaaaagaccacaagttcaagaa
cgtttgactatgcaaattgtcgaatctttacaaaaaatgttaaaaacacaagatgttgct
tgtgtaataaaagcaaaacacttatgtgtcaattctcgtggaattcgagatatagatagt
agtacagtaacaacggaattagtaggatctttcaaaaaaaattcagaaattagaagagaa
tttcttcatcacattggaatttcttaa

DBGET integrated database retrieval system