KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_591Help
Entry
BLBBGE_591        CDS       T00995                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00020  Citrate cycle (TCA cycle)
bbl00640  Propanoate metabolism
bbl00660  C5-Branched dibasic acid metabolism
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01200  Carbon metabolism
Module
bbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBBGE_591 (sucC)
   00640 Propanoate metabolism
    BLBBGE_591 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BLBBGE_591 (sucC)
Enzymes [BR:bbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BLBBGE_591 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACY40591
UniProt: D0JBQ3
Position
complement(591427..592626)
Genome map
AA seq 399 aa AA seqDB search
MNLHEYQGREILNSFSIQVPYGILASSPEESVEAAKIIFKRTGKKSLVIKAQIHAGGRGK
AGGIQIAKTLDEVYEKSKNILGKFLITPQTSKKGKLVRKILLSEDIYSNELNSPIEYYLS
ILLNRDIEKDIILYSKEGGVEIENLSKKNPNKIYTEEIDPILGLQLFQTRKIAFNLGMDS
DTLKNFSSFLISLYKAYKAYDALLLEINPLIKTFDNKIIPVDIKIVLDDNALFRHKKYAI
NNDSKDIDFLEKEANEAHLNFLKLEGNVGCMVNGAGLAMATMDMIKFCGGEPANFLDIGG
SADKKRVEKAFSLILRDKSVKTILINIFGGIVRCDTVSEGIINSYSKIDHDIQIPVVVRL
QGTNERIAKKMLQNSLLPIYSTDTLKDAADKIKEILQIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaataccaaggtagagaaatattgaattctttttcaattcaagttcca
tatggaatacttgcttcttctccagaagaatctgtagaagcagcaaaaattatttttaaa
agaactggaaaaaaatctttggtaattaaagcccaaattcacgcagggggacgtggaaaa
gctggtggtattcaaattgcaaaaactttagatgaagtttacgaaaaatctaaaaatatc
ttaggaaaatttctaataactccacaaacttctaaaaaaggaaaattagttagaaaaatt
ttattgtctgaagatatctattctaacgaattaaattcacctatagaatattatttatct
atattgcttaatcgtgatatagaaaaagatataattctttattccaaggaaggaggagtt
gaaatcgaaaatctttccaaaaaaaatccaaataaaatctatacagaagaaatagatcca
atattaggattgcaattatttcaaaccagaaaaattgcttttaatctaggaatggacagt
gatactttaaaaaattttagttcttttttaatttctctttataaagcttataaagcttat
gatgctttactattggaaataaatcctttgatcaaaacatttgacaacaaaattattcct
gtagatataaaaattgtattagatgataatgctttgtttcgtcataaaaaatatgccatt
aataatgactcaaaagatattgattttcttgaaaaagaagcgaatgaagctcatttgaat
tttttaaaattggaaggaaatgtaggatgtatggtgaatggagcggggttagctatggct
acaatggatatgatcaaattttgtggaggagaaccggctaattttttagatataggaggt
tctgcggataaaaaacgtgtagaaaaggctttttctcttatattaagagacaaatctgtt
aaaacaatattgattaatatatttggaggaatagttcgttgtgatactgtatcagaagga
atcattaattcatattctaaaattgatcatgatatccaaataccagtggttgttcgtttg
caaggaacaaatgagagaatagcaaaaaaaatgcttcaaaatagtttacttcctatttat
tctacagatacattaaaagacgctgccgataaaattaaagaaattttgcagataaaataa

DBGET integrated database retrieval system