KEGG   Bordetella bronchiseptica MO149: BN115_0639Help
Entry
BN115_0639        CDS       T02295                                 

Definition
(GenBank) probable thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00071  Fatty acid degradation
bbm00072  Synthesis and degradation of ketone bodies
bbm00280  Valine, leucine and isoleucine degradation
bbm00310  Lysine degradation
bbm00362  Benzoate degradation
bbm00380  Tryptophan metabolism
bbm00620  Pyruvate metabolism
bbm00630  Glyoxylate and dicarboxylate metabolism
bbm00640  Propanoate metabolism
bbm00650  Butanoate metabolism
bbm00900  Terpenoid backbone biosynthesis
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
bbm01212  Fatty acid metabolism
bbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN115_0639
   00630 Glyoxylate and dicarboxylate metabolism
    BN115_0639
   00640 Propanoate metabolism
    BN115_0639
   00650 Butanoate metabolism
    BN115_0639
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN115_0639
   00072 Synthesis and degradation of ketone bodies
    BN115_0639
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_0639
   00310 Lysine degradation
    BN115_0639
   00380 Tryptophan metabolism
    BN115_0639
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN115_0639
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN115_0639
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN115_0639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbm04147]
    BN115_0639
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN115_0639
Exosome [BR:bbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN115_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ57395
Position
complement(684806..685990)
Genome map
AA seq 394 aa AA seqDB search
MREAVIVSTARTPIGKAYRGAFNQTHGAELGGHSLRHAIARSKVDPAEIEDVIIGCGMPQ
GATGYNIGRQIAICGGLPIETGGTTVNRLCASGLQAIAIAAQRIMVDRVPVMAAGGLECI
SIVQDEHHNGVKKSPWIEAHKPHTYDAMLRTAEVVAQRYGVSRDAQDDYAFQSQMRTAAA
QRDGLFDDEIVPMTTVKLSKNKETGATYEEEVTLLRDEGNRPDTTREGLATLQPVMEPDT
SITAGNASQLSDGSSACILMEAKEAERRNLEPLGAFRGFVATGCEPDEMGIGPILAVRTL
FQRFGLRMEDIDLWELNEAFASQTVYCRDQLGIPNELLNVNGGAISVGHPYGMSGARMVG
HALIEGRRRGARLVVVSMCVGGGMGAAGLFEVYR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgtaatcgtttcaaccgcccgtaccccgataggcaaggcctaccgcggc
gccttcaaccagacgcacggcgccgaactgggcggccattcgctgcggcacgccatcgcc
cggtccaaggtcgacccggccgagatcgaggacgtcatcatcggctgcggcatgccgcag
ggcgccaccggctacaacatcggccggcagatcgccatatgcggcggcctgcccatcgaa
acgggcggcaccaccgtcaaccgcctgtgcgcctcgggcctgcaggccatcgccatcgcc
gcccagcgcatcatggtggaccgggtgcccgtcatggccgccggcggcctggagtgcatc
agcatcgtccaggacgagcaccacaacggcgtcaagaaaagcccctggatcgaggcccac
aaaccgcacacctacgacgccatgctgcgcacggccgaagtggtggcgcaacgctacggc
gtcagccgcgacgcgcaggacgattacgccttccagagccagatgcgcacggccgcggcg
cagcgcgacggcctgttcgacgacgagatcgtcccgatgacgaccgtcaagctgagcaag
aacaaggaaaccggcgccacctacgaagaagaagtgaccttgctgcgcgacgagggcaac
cgccccgacaccacgcgcgaaggcctggcgaccctgcagccggtgatggagccggacacc
tccatcaccgccggcaatgcctcgcagctctcggacggctcgtcggcctgcatcctcatg
gaagccaaggaagccgaacgccgcaacctcgaaccgctgggcgcgttccgcggcttcgtg
gccaccggctgcgagccggacgaaatgggcatcggccccatcctggcggtccggacgctg
ttccagcgcttcggcttgcgcatggaggacatcgacctctgggagctcaacgaggccttc
gccagccagaccgtgtactgccgcgaccagctcggcatccccaacgaactgctcaacgtc
aacggcggggcgatctcggtgggccacccgtacgggatgagcggcgcgcgcatggtcggc
cacgccctgatcgagggccgccgccgcggcgcgcgcctggtggtcgtcagcatgtgcgtg
ggcggcggcatgggcgcggccggactgttcgaagtgtatcgataa

DBGET integrated database retrieval system