KEGG   Bordetella bronchiseptica MO149: BN115_0769
Entry
BN115_0769        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbm02044]
    BN115_0769
Secretion system [BR:bbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN115_0769
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CCJ57525
Position
821416..821985
AA seq 189 aa
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVG
ERKFLDVDIDNFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGA
LNEMLEARTQLANLLTYMDGKTGAEELIGQVLQNPALLGALAAAPKPADAGPADADADAE
SAQPGPQAR
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcaaccacgctcaaaggcagcggccagaaattcatcgccaggaatcgcgcgccgcgc
gtgcagatcgagtacgacgtggaaatctacggcgccgagcgcaagatccagctgccgttc
gtcatgggcgtgctggccgacttggccggcaagtcgaatacgccgcagcccgaagtgggc
gagcgcaagttcctcgacgtcgatatcgacaatttcgacgagcgcatgaagtcggtcgcc
ccgcgggccgcgttccaggtggccaatacgctgaccggcgccggccatctgaacgtggac
atcaccttcgagagcatcgacgacttttccccggccaccgtggcgcgcaaggtgggcgcg
ctcaacgagatgctggaggcccgcacgcagctggccaatctgctgacctacatggacggc
aagaccggcgcggaggagctgatcggccaggtgctgcagaacccggccctgctgggcgcg
ctggcggccgcgcccaagcccgccgacgccggcccggccgatgccgacgccgacgccgag
agcgcgcagcccggcccgcaagcccgataa

DBGET integrated database retrieval system