KEGG   Bordetella bronchiseptica MO149: BN115_0771Help
Entry
BN115_0771        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN115_0771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbm02044]
    BN115_0771
Secretion system [BR:bbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN115_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CCJ57527
Position
823585..824052
Genome map
AA seq 155 aa AA seqDB search
MKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGAGKASFNDLHVVARIDKAA
PAVMKHCASGKHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQIAADNGSEAVLVNYAF
QAAKVRQQYWEQTESGGKGAESLVAWDIKQNKEIG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgaaggcgccaatggcgaatccaaggacgccaaccacaaggactggaccgat
atcgtgtccttttcgtggggcgccacccagccggccagcctggcgaccggcggcggccag
ggcgcgggcaaggccagcttcaacgatctgcacgtggtggcccgcatcgacaaggcggcg
ccggcggtcatgaaacactgcgccagcggcaagcacctgggcaagatcgaactgtcggtg
tgcaaggcgggcggcgcgcaggtcgagtacagcaaggtcacgctggaagacgtgctggtc
acctcggtgcagatcgccgcggacaacggttcggaggcggtgctggtcaactatgccttc
caggccgccaaggtgcgtcagcagtactgggagcagaccgagtcgggcggcaagggcgcc
gagagcctggtcgcgtgggacatcaagcagaacaaggaaatcggctga

DBGET integrated database retrieval system