KEGG   Bordetella bronchiseptica MO149: BN115_0774Help
Entry
BN115_0774        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbm02044]
    BN115_0774
Secretion system [BR:bbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN115_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: CCJ57530
Position
825426..827336
Genome map
AA seq 636 aa AA seqDB search
MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPYVERLLEGFSFLAARI
HLKMDAEFPRFTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTLAGGFTLPRGTVLRGGL
ARGEQTPCEFMTGHALRLWPLRVTAAEFTGAPTDLPLARLGLGGREAGVASALRLRLEVC
GGVSLEELDLDQLVFYLNGPDAPMQRLLELVMCHTVAVLGHDSERPVSWINRLPADAVRH
EGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNGLKQGLRTPRAAAAAAGPAGT
RRFDLTLLLSAAAPELEGAISAENLALHCAPIVNLFPRRADRVAVTPRHHEYHVVVDRTR
PLDFEVYGLTRVLGHMSAQRPEQEFRPFYGSFGADADDYGAYYSLRREPRLASDSARRHG
TRTSYTGSEVYLSLVDRQEAPFADTLRHLGIDALCTNRDLALLLPLGGASDFSLRVSAPV
GAIKVLHGPSRPAAAMAEHGTAWQLISHLGLHYHSLTDLDETRGAQTLRELLNLYGNLAD
PVARKHISGVRHVRVEPMHHRLPVPGPIVYGRGVRIDLQVDETAFSGISPYLFGAVLEQF
FARHVSINMMSALTLSTPQRGAVASWRPRMGRRPAV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgcctgctcgactactacaaccgcgagctggtctacatgcgcgagctgggc
gccgagttcgcgcgccagcatcccaaggtggcggggcggctgggcatgcacggcaccgag
gtggccgatccgtacgtcgagcgcctgctcgaaggcttcagcttcctggccgcgcgcatc
cacctgaagatggacgccgagtttccgcgcttcacgcagcggctgctggaggtggtgcat
ccgcactatctcgcgcccaccccggcgatggcggtggcgcagttctcgcccagcatgaac
gaaggcacgctggccggcggctttaccctgccgcgcggcaccgtgctgcgcggcggcctg
gcgcgtggcgaacagacgccgtgcgagttcatgaccggccacgcgctgcggctgtggccg
ctgcgcgtgaccgctgccgaattcaccggcgcgcccaccgacctgccgctggcccgcctg
ggcctgggcggacgcgaggccggcgtggccagcgcgctgcgcctgcggctggaagtctgc
ggcggcgtcagcctggaagagctggacctggatcaactggtgttctacctcaacgggccg
gacgcgcccatgcagcgcctgctggagctggtcatgtgccacacggtcgccgtgctgggc
cacgacagcgagcggcccgtctcgtggatcaaccggctgccggccgacgcggtgcgccac
gaggggttcgccgacgaccaggcgctgctgcccaccgacacgcgggttttccagggctat
cggctgctgcaggagtacttcgcgttcgcgcgccgctacctgttcttcagcctgaatggc
ctgaaacagggcctgcgcacgccgcgcgcggcggccgcggcggccggcccggccggcacc
cggcgtttcgacctgacgctgctgctgtcggccgccgcgcccgagctcgaaggcgcgatc
tcggccgagaacctggcgctgcactgcgcgcccatcgtcaacctgtttccgcgccgcgcc
gaccgcgtggcggtcacgccgcgccaccacgagtaccacgtggtggtcgaccgcacccgg
ccgctggacttcgaggtctatggcctgacgcgggtgctcggccatatgtcggcgcaacgc
cccgaacaggagttccgtccgttctacggctcgttcggcgcggacgccgacgattacggc
gcctactactcgttgcggcgcgagccgcggctggcctcggacagcgcgcgccgccacggc
acgcgcaccagctataccggcagcgaagtctatctgtcgctggtcgaccgccaggaggcg
ccgttcgccgacacgctgcgccatctcggcatcgacgccctgtgcaccaaccgcgacctg
gcgctgctgctgccgctgggcggcgccagcgacttcagcctgcgcgtgtccgccccggtg
ggcgcgatcaaggtgctgcatggcccgtcgcggccggccgcggccatggcggagcacggc
acggcatggcaattgatcagccacctggggctgcactaccacagcctgaccgacctggac
gagacgcgcggcgcgcagacgctgcgcgagctgctcaacctgtacggcaacctggccgac
ccggtggcgcgcaagcatatctcgggcgtgcgccacgtgcgggtcgaacccatgcaccac
cgcctgcccgtgcccggtcccatcgtctacggccgcggcgtgcgcatcgacctgcaggtc
gacgagaccgccttctcgggcatcagcccctacctgttcggcgcggtgctggagcagttc
ttcgcgcgccacgtctccatcaacatgatgtcggcgctcaccctgtccacgccgcagcgc
ggcgccgtggcgagctggcggccccgcatgggccgccgccccgcggtctag

DBGET integrated database retrieval system