KEGG   Bordetella bronchiseptica MO149: BN115_0776
Entry
BN115_0776        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbm02044]
    BN115_0776
Secretion system [BR:bbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN115_0776
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CCJ57532
Position
828027..829121
AA seq 364 aa
MSMDAAARTDRHAAPAALPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRH
EPVRMRQEPSLAFAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLHLTEHARERRQH
HGDHALTAFADLFHHRLILLFYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRD
SVMDHAKYHMAGHLLRQTRNPEGLCQVLRAFFGLPVGVDEFVAQWIRLEAGQRLRLGAGG
GLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSVRARQLLHWVRLYVGVEFAWEV
RPVLRRDAVRGVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQAARRAQAFHGE
EQAA
NT seq 1095 nt   +upstreamnt  +downstreamnt
ttgagcatggacgcagcggccaggacggatcgacacgcggcgccggcggcgttgccgcct
gccttctggcaggccctggcggcggcgccgcacgggcacgacctgtttcacgtgctgcgc
tggatcgacgcgcgcgccggcgcgcgcgcgccgctgggccgcggcgcctcgccgcgccac
gaaccggtgcgcatgcggcaggagccttcgctggctttcgcgccggccaccctggccgcg
gcgcgcgcgccgggcgagggcgccgcgcccgagctgtccatctacagcttcggcctgttc
ggtcccaatgggccgctgccgctgcacctgaccgagcacgcccgcgaacgccgccagcat
cacggcgaccatgccctgaccgcgttcgccgacctgttccaccatcgcctgatcctgctg
ttctaccgcgcctgggccgatgcgcaatccaccgccagcctggaccgcggccaggagcgc
ttcagcggctacgtggccagcctgctgcacctgggcgcgccgtcgctgcgccggcgcgac
agcgtgatggaccatgccaagtaccacatggccggccatctgctgcgccagacccgcaac
ccggaaggcctgtgccaggtgctgcgcgccttcttcggcctgcccgtgggggtagacgag
ttcgtggcgcagtggataaggttggaggccggccagcggctgcggctgggggcgggcggc
gggctgggcggcggcgcgcccctgggcgtggccgtgcgcgacgcccagcacaagttcagg
atccgcctcgggccgctggactggcaggactacctggcgttcctgcccggttcggtccgc
gcgcgccagctgctgcattgggtgcgcctgtatgtgggcgtggagttcgcctgggaggta
cggccggtgctgcgccgcgacgcggtgcgcggcgtgcgcctgggcgcggcggcgccgctg
gggctggcgtcctggctgggccggcggccgccgcgcctgggcgacgccgccgagctgttg
ctggactacgaggggcgcgagcgccaggcggcgcggcgcgcgcaagcgtttcatggagag
gagcaagcggcatga

DBGET integrated database retrieval system