KEGG   Bordetella bronchiseptica MO149: BN115_0785
Entry
BN115_0785        CDS       T02295                                 

Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN115_0785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbm02044]
    BN115_0785
Secretion system [BR:bbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN115_0785
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_28
Other DBs
NCBI-ProteinID: CCJ57541
Position
837434..841039
AA seq 1201 aa
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIVALFAFAL
LRLLWRKWREGRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFD
GGGGRGWLQRYSRQYLYQLPWYVIIGAPGSGKTTALVNSGLNFPLAERFGKAALRGVGGT
RNCDWWFTDDAVLLDTAGRYTTHESDPTGDEESWRGFLGLLTRFRGRQPINGAMLTVSIE
DLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTKADLLAGFEQYFASFSREDLE
QVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEARRALAYLLPQQ
FAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWL
ASYGNNARYLDEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPP
LSYRFGLYQGGKMHAAMQGVYRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYL
MLYEADHYDAEFMHAWLLSDMQGTLPEGYTRRQYDLMSLHLRQLAQGGVLASPFPRDEAL
VRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLGGPQASAVFVRKSGKPLAQGI
AALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIVDIKRLYLNDY
VARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGA
PIAATTSLVNELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGA
AGEVSGVARERLGEDLYATIGLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEF
FQKNLVSQIDVSEARWRFKPGMDGTPGQASALLDSFQRAAAIRDAYFMAGSAEPAFRVSI
RPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRGANQVRIELTPQAGAAGLSAS
GPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLAEMRGFSCPGR
S
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgatcccgcgcctgttcggatggctgttctcgcgcggcctgtggagcttcctgggcctg
gtggcgctggccctgctggtgtggatcgccgggccgctgctggcgatcggcgcgctgcgc
ccgctggaaagcgagaccgcgcgcgtgctggtcatcgtcgcgctgttcgccttcgcgctg
ctgcgcctgctgtggcgcaagtggcgcgaaggccgcctcaacgcccagctgctgggccag
ctgcgccggccggcccggcccgaggccgaggccgcggccgagccgccgccttcggacctg
cgcgaactggaaggccgcttcgacgaggcggtggagctgttgcgcaagacgcgcttcgac
ggaggcggcgggcgcggctggctgcagcgctattcgcgccaatacctgtaccagctgccc
tggtacgtcatcattggcgcgccaggctcgggcaagaccacggccctggtcaactcgggc
ctgaacttcccgctggccgagcgcttcggcaaggccgcgctgcgcggcgtgggcggcacc
cgcaactgcgattggtggttcaccgacgacgcggtgctgctcgataccgccggacgctac
accacccatgaaagcgaccccaccggcgacgaggagtcctggcgcggctttctcggcctg
ttgacgcgcttccggggccgccagcccatcaacggcgccatgctcaccgtcagcatcgag
gacttgctggccgcttccgacgccgagcgcgcgcgccacgctgcggtgctgcgccggcgc
ctgcaggagctgcgcgagcagctgggcatccatttcccggtgtatgtgctggtgaccaag
gccgacctgctggccggcttcgagcagtacttcgcctcgttcagccgcgaagacctggag
caggtatggggcttcaccttgccctacgcgcgcgcccaggagccggacttcgacctgtac
gaagcctttcatgccgagtaccggctgctgcagcgccggctcgacgacgccctgcccgaa
gtgctggccgccgagccggacgaggcgcgccgcgcgctggcctacctgctgccgcagcag
ttcgccggcctgcaggccgtgctgggccatttcctcagcgacgtgttcgccagctcgcgc
ttcgaggagcgcctggtgccgcgcggcgtgtacttcaccagcggcacccagggcggcgag
accttcgaccaggtcaccggccacctcaagcgctatctgcgcatcgaaagcgggccggcc
ccggccgccgccgaggaaggccgcagcttcttcctcaagcggctgctgcaggacgtgatc
tttcccgaggccggcctggccggccgcaacctgcgctgggagcgccgctaccgccgcctg
cactgggccggctacggcctgatcacgctggcgttcctgggcctggcggcgggctggctg
gccagctacggcaacaacgcgcgctacctcgacgaagtggcgcgccgcgtgccgacggtg
gacaagctggggcgcgatatcaagatcacccgctcgggcgatgtgctgggcctgatgccc
ttcctggacggcctgtggtacctgccgcgcgacgccgccttcgagccggacgcgccgccg
ctgtcctatcgcttcgggctgtaccagggcggcaagatgcacgccgcgatgcagggcgtt
tatcgcggcacgctcgacagcgtcctgctgccgcaggtggcgcgccgcatcgaggcggcg
ctgcgcgcggcccgcgccgacgacctggagtacggctacgaggccctgcgcgcctacctg
atgctgtacgaggccgaccactacgacgccgagttcatgcacgcctggctgctgtccgac
atgcagggcacgctgcccgagggctacacgcgccggcagtacgacctgatgtcgctgcac
ctgcgccagctggcgcagggcggcgtgctggcctcgccgtttccgcgcgacgaggcgctg
gtgcggcaggcgcgcgacgaactggcgcgccacacgctggcgcagcgcgcctacagccgg
ctgcgccgcatgctggccggcgccgacgatcagccgcccaccaccgcggtgacgctgggc
gggccgcaggccagcgccgtcttcgtgcgcaagagcggcaagccgctggcccagggcatc
gcggcgctgtacacctaccgcggctattgggacgtgttcaatccgcgcgtcacgcgcgtg
gccgagcgcctgcgcagcgacgatgcctgggtcctggacatcgcgccgccgggcgtgctg
gacgaggccgcgcgccagcagctcatcgtcgacatcaagcgcctgtacctcaacgactac
gtggcgcgctgggacggctacctggacgacctggcgctggcgccgcgcagctcgctgctg
caaagcatccagctggcgcgcaccctgtcggcgcccgattcgccgctggtgcggctgacc
cagggcgtggcgcgcgagaccacgctgttgcgcgacgcgggcggcgacgagcgctcgctg
gcggaccaggcgcgcgaccgcgtcagcagcacgcgcgaggcgctggagcagatgttcggc
ccgaccggcccgggcgcggccacgcgcgccgacgccggcgacggcaagctggagcgcgtg
gtcgaccagcacttcgagccatggcgcaggctggcgcgcgccgacgggcagggcggcgcg
ccgattgccgccaccaccagcctggtcaacgagctgtacacctacctgacggcggccgac
gcggccctgcgcagcgccagcccggcgcccgcctccgatgtggtgaccaagctgcgcgcc
gaggctggccgcctgccgcggcccttgcgcgacgtgctcgacgacttgtccaccggcgcg
gcgggcgaagtgtccggcgtggcgcgcgagcggctgggcgaagacctgtacgccaccatc
ggcctgttctgccgccaggccatcgccggccgctatcctttcgcgcccggctcgccgcgc
gacgtcgcgcccaatgacctggcgcggctgttcgcgcccaacggcatgatggacgagttc
ttccagaagaacctggtcagccagatcgatgtgtccgaggcgcgctggcgcttcaagccg
ggcatggacggcacgccgggccaggcgtcggcgctgctggattcgttccagcgcgccgcc
gcgatccgcgacgcctatttcatggccggcagcgcggagccggcgtttcgcgtctcgatc
cgtccggtggaaatggacccggccatcacgcaattcgtcatggacgtggacggccagacc
gtgcgctatgcgcatggcccgcaggtcgccacctccgtgcaatggccggggccgcgcggc
gccaaccaggtgcgcatcgagcttacgccccaggccggcgcggcgggcctgtcggccagc
ggaccgtgggccctcaatcgcctgctcgaccaggcccgcgtcacgcgcggcgcctcgccc
gagatctcgctggccagcttcgatatcggcggccgcaaagtggtgctggagatccgcgcg
ggcagcgtcaggagccccttccatctggccgagatgcggggcttttcctgcccgggccgt
tcatga

DBGET integrated database retrieval system