KEGG   Bordetella bronchiseptica MO149: BN115_1907Help
Entry
BN115_1907        CDS       T02295                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbm03016]
    BN115_1907 (truB)
Enzymes [BR:bbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BN115_1907 (truB)
Transfer RNA biogenesis [BR:bbm03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BN115_1907 (truB)
 Prokaryotic type
    BN115_1907 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: CCJ58663
Position
2056806..2057540
Genome map
AA seq 244 aa AA seqDB search
MAKRRGLALDGVLLLDKPVGLSSNHALQRAKRTVDAAKAGHTGTLDPFATGLLVCCMGRA
TKISGRMLEADKTYQATLQFGEETDSGDLTGHIVARAPDGFAGVEEAALRDVLSRFVGTI
EQIPPMYSALKRDGKPLYEYARAGIELDRPPRQVTIRHIELLSFSGMQAQIDVACSKGTY
IRTLAQDIGRALGCHAHLAALRRTHVGPFSLDRAVTLEALQAMPDAKQALLAMNELPAGL
LPAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacgacgcgggctcgcgctcgacggtgtgctgttgctggacaaacccgtgggt
ttgtccagcaaccacgccttgcagcgagccaagcgcaccgtggacgcggccaaggccggt
catacgggaacgctggaccctttcgccaccggcctgctggtttgctgcatgggccgggct
accaagatctcgggccgcatgctcgaggccgacaagacctaccaggccacgctgcagttt
ggcgaggagaccgactcgggcgacctgaccggccacatcgtggcccgggccccggacgga
tttgccggtgtcgaagaggcggcgctgcgcgatgtgctgtcacgtttcgtgggcacgatc
gagcagatcccgcccatgtattcggcgctcaagcgcgacggcaagccgctttacgagtac
gcccgggcgggcatcgagctggaccgtccgcccaggcaggtgaccatccgccacatcgag
ctgctgtcgttctccggaatgcaggcgcagatcgatgtggcctgcagcaagggcacctat
atacgcacgctggcccaggacatcggccgcgcgctgggctgccatgcccacctggcggcg
ctgcggcgcacgcacgtcgggccgttttcgctggaccgcgccgtaaccctggaagccctg
caggcgatgcccgacgccaagcaggccttgcttgccatgaatgaattgccggcgggcctg
ctgcccgccacctga

DBGET integrated database retrieval system