KEGG   Bordetella bronchiseptica MO149: BN115_2011Help
Entry
BN115_2011        CDS       T02295                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00071  Fatty acid degradation
bbm00072  Synthesis and degradation of ketone bodies
bbm00280  Valine, leucine and isoleucine degradation
bbm00310  Lysine degradation
bbm00362  Benzoate degradation
bbm00380  Tryptophan metabolism
bbm00620  Pyruvate metabolism
bbm00630  Glyoxylate and dicarboxylate metabolism
bbm00640  Propanoate metabolism
bbm00650  Butanoate metabolism
bbm00900  Terpenoid backbone biosynthesis
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
bbm01212  Fatty acid metabolism
bbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN115_2011
   00630 Glyoxylate and dicarboxylate metabolism
    BN115_2011
   00640 Propanoate metabolism
    BN115_2011
   00650 Butanoate metabolism
    BN115_2011
  Lipid metabolism
   00071 Fatty acid degradation
    BN115_2011
   00072 Synthesis and degradation of ketone bodies
    BN115_2011
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_2011
   00310 Lysine degradation
    BN115_2011
   00380 Tryptophan metabolism
    BN115_2011
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN115_2011
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN115_2011
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN115_2011
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN115_2011
Exosome [BR:bbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN115_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ58767
Position
complement(2175469..2176665)
Genome map
AA seq 398 aa AA seqDB search
MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASAGIEPRAIEAAWYSSHYDD
IGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKD
TGFAGLPLASRGTLAPMYLPTHSNPGNFAQLARAYQARHGVAREDLKAAMAHTSMKSHAN
ALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRGPLV
LVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSIT
ELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGLKCFGHPVGASGLRMLYEAWLQ
LSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatcaaggatcgcgtcgccattctggcgatgggctgttcccgtttcggc
gaacgctgggacgtgggccaggaagaattgatggtcgaggcctacgccgaggcgctcgcg
agcgccggcatcgagccgcgcgccatcgaggcggcctggtactcgtcgcactatgacgac
atcggcgcgggcaaggccggcacgcccatggccatggccctgcgcctgcccgacatcggc
gtgacgcgcgtggagaacttctgcgccggcggcaccgaggcgtttcgcggcgccgtctac
gcagtcgcctccggcgccgcggacatcgcgctggcgctcggggtggaaaagctgaaagac
accggcttcgccggcctgccgctggcctcgcgcggcacgctcgcgcccatgtacctgccc
acgcacagcaacccgggcaacttcgcgcagctggcccgcgcctaccaggcccgccacggc
gtggcccgggaggacctcaaggcggccatggcccatacctcgatgaaaagccatgccaac
gccttgcacaatcccaaggcgcacctgcgcaaggccatcagccgcgaacaggccgccggc
gcgccgctggtggccgaccccatcggactgttcgattgctgtccggtgtcggacggcgcc
gcctgcgccatcgtcaccacgcccgagatcgcccgcagcctgaaccgcggcccgctggtc
ctggtcaaggccatccagctggccacgtccaacggctgggagctgcagcaatcggactgg
gacggctcgtacgtgcacaccacccgcgtggcggcgcgcaaggcgtacgccgaagcgggc
atcgacgatccgcgcgcgcagctcagcctgaccgaattgcacgactgcttctcgatcacc
gaactggtgacgctggaggacatcggcctggccgagcccggcacggcctggcgcggcatg
ctcgacggccgcttcgatgccgacggggcgctgccctgccagatagacggcggcctgaaa
tgcttcggccatcccgtaggggcctcggggctgcgcatgctctacgaggcctggctgcaa
ctgagcggccgcgccggcgcgcgccagctgcccgcgccctcgctggccctgacccacaat
ctgggcggcgcgcccgcgcagaacgtgtgttcgatcacaatactcggcgcggcctga

DBGET integrated database retrieval system