KEGG   Bordetella bronchiseptica MO149: BN115_3759Help
Entry
BN115_3759        CDS       T02295                                 

Definition
(GenBank) probable oxidoreductase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00650  Butanoate metabolism
bbm01100  Metabolic pathways
bbm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN115_3759
Enzymes [BR:bbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     BN115_3759
    1.1.1.373  sulfolactaldehyde 3-reductase
     BN115_3759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C UDPG_MGDP_dh_N IlvN ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCJ60515
Position
complement(4113953..4114903)
Genome map
AA seq 316 aa AA seqDB search
MQKHKIAFLGLGAMGLPMACNLVKGGHAVTGYDLNPQALDALAQAGGQRAASAREAAAGA
GLVIAMLPTATHIQAALEGADGALQGMDPSALFINMSTILPQETDLIAQRLAERGMRMLD
SPVGRSAMEAQRGTLLILASGSAPDKARARDALLCMGNQVIDCGEVGGGSRVKVVNNFMG
ISLNALTAEALTLAEASGLSVELALEVMRGTIAGLGHMNITYPNKVLRGDLSAGFQVDLA
HKDLGLALELAARSRACVPMGSAAFQSYTAARAQGRGGQDYSAIYPVMRSLSGLPEALPY
QVDAPVEADPFGAAAR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcacaagatcgcatttctcggcctgggcgcgatgggcctgcccatggcctgc
aacctggtcaagggcggccatgccgtcaccggctacgacctgaatccgcaagcgctggac
gccctggcgcaggccggcggccagcgcgccgccagcgcgcgcgaggcggcggccggggcc
ggcctggtcatcgccatgctgccgaccgcgacgcatatccaggcggcgctcgaaggcgcc
gacggcgccctgcagggcatggacccgagcgcgctcttcatcaacatgtccaccatcctg
ccccaggaaaccgacctgatcgcgcagcgcctggccgagcgcggcatgcgcatgctggat
tcgccggtcggccgctccgccatggaggcgcagcgcggcacgctgctgatcctcgccagc
ggcagcgcgccagacaaagcgcgcgcccgcgatgcgctgctgtgcatgggcaaccaggtt
atcgattgcggcgaagtgggcggcggctcgcgcgtgaaggtggtcaacaacttcatgggc
atttcgctcaatgccctgacggccgaggccctgaccctggccgaggccagcggcctgagc
gtcgagctggccctggaggtcatgcgcgggaccatcgccggcctggggcatatgaacatc
acctatccgaacaaggtgctgcgcggcgacctgtcggcgggtttccaggtcgacctggcg
cacaaggacctcggcctggcgctcgaactggcggcgcgcagccgggcctgcgtgccgatg
ggcagcgcggcattccagtcctatacggcggcgcgtgcgcagggccgtggcggccaggat
tacagcgcgatctatccggtcatgcgcagcctgtcgggcctgcccgaggcgctgccttac
caggtggatgcgccggtcgaggccgatccgttcggggcggcggcacgctga

DBGET integrated database retrieval system