KEGG   Bordetella bronchiseptica MO149: BN115_3905Help
Entry
BN115_3905        CDS       T02295                                 

Definition
(GenBank) putative gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00430  Taurine and hypotaurine metabolism
bbm00460  Cyanoamino acid metabolism
bbm00480  Glutathione metabolism
bbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BN115_3905
   00460 Cyanoamino acid metabolism
    BN115_3905
   00480 Glutathione metabolism
    BN115_3905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bbm01002]
    BN115_3905
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BN115_3905
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BN115_3905
Peptidases and inhibitors [BR:bbm01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BN115_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CCJ60661
Position
4279202..4280809
Genome map
AA seq 535 aa AA seqDB search
MMKFDWNNPYPSTRIPVFARNVVATSHPLAAQAGLRILALGGNAADAAVASAATLALVEP
ASNGLGSDCFALVWDGARLHGLNASGTAPAAWSPGYFQRKHQGAIPLRGWDSVTIPGCVA
GWASLHDKLGSLPFADVLAPAIEYAERGFAVPPTVQRRWADQVDPLRSLPGFAEHFLPHG
RAPEVGEHFVLAGAAATLRRIAASGGRDFYEGETAQKLVAHAQAHEAALTLGDLRDYAPQ
WVEPISQAYRGHALHQLPPNGQGLAALIALGIVEHFDLASRPAEHPDTQHILIEAMKLAF
ADVHAHVADAAHMRIRVEQLLDPAYLAERARLIDLRRARVYNAAQAPQGGTVYLACADRN
GMMVSFTQSNYMGFGSGIVVPGTGISLQNRGCCFSMDPDHPNVVGGGKRPFHTGIPAFLT
QDGAPLMSFGIMGGNMQPQGHLQALVRMLDYRQQPQAACDAPRWKWNRGLSVDIEAAMPA
QVTDALRARGHIVEVAAPADKDFGSGQFIWRLGDPAVDGYVAASDSRRDGLAAGF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagttcgattggaacaacccctaccccagcacccggattcctgttttcgcgcgc
aacgtggtcgccacgtcccacccgctggcggcgcaggccgggctgcgcatcctggcgctc
gggggcaacgccgcggatgcggcggtggccagcgccgcgacgctggcgctggtcgagcca
gccagcaatggcctgggctcggattgtttcgccctggtctgggatggcgcccgcctgcat
ggcctgaacgcctcgggcaccgccccggcggcgtggagccccggctatttccagcgcaag
catcagggcgcgatcccgctgcgcggctgggacagcgtgaccataccgggctgcgtggcg
ggctgggccagcctgcacgacaagctgggcagcctgcccttcgccgacgtgctggcgccc
gccatcgaatatgccgagcgcggcttcgcggtgcccccgacggtgcagcgaagatgggct
gaccaggtggacccgctgcgcagcctgcccggattcgccgaacacttcctgccgcatgga
cgcgcgcccgaggtgggcgagcatttcgtgctggcgggcgcggccgccacgctgcggcgc
attgccgccagcggcgggcgcgatttctacgaaggcgaaacggcgcagaagctggtggcg
cacgcgcaggcccacgaggcggcgctgacgctgggcgacctgcgcgattatgcgccgcaa
tgggtcgagcccatcagccaggcctaccgcggccatgcgttgcaccagctgccgcccaat
gggcagggcctggcggccctgatcgcgctggggatcgtcgaacacttcgacctggcatcg
cgccccgccgaacatccggatacccagcacatcctgatcgaagccatgaagctggcgttt
gccgatgtccatgcgcacgtggccgacgcggcgcacatgcgcatccgcgtcgaacagctg
ctggacccggcctacctggccgaacgcgcgcgcctgatcgacctgcgccgcgctcgcgtc
tacaacgccgcgcaggcgccgcagggcggcaccgtctacctcgcatgcgccgaccgcaat
ggcatgatggtcagtttcacccagtccaattacatggggttcggatccggcatcgtggtg
ccgggcaccggcatcagcctgcagaaccgcggctgctgcttcagcatggaccccgatcat
ccgaacgtcgtgggcggcggcaagcgtccgttccacaccggcattcccgccttcctgacg
caggatggcgcgccactgatgagtttcggcatcatgggcggcaacatgcagccgcaggga
catctgcaggcgctggtgcgcatgctcgactatcggcagcagccgcaggcggcatgcgat
gcgccgcgctggaaatggaaccgcggactctcggtcgatatcgaggccgccatgcccgcg
caggtgaccgacgccctgcgtgcccgcggccatatcgtggaggtcgcggcgccggccgac
aaggatttcggttcgggccagttcatctggcgcctgggggatccggcggtcgatggctat
gtcgcggccagcgacagccgccgcgacggactcgccgcgggcttttga

DBGET integrated database retrieval system