KEGG   Bordetella bronchiseptica MO149: BN115_4299Help
Entry
BN115_4299        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN115_4299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CCJ61055
Position
complement(4701365..4701739)
Genome map
AA seq 124 aa AA seqDB search
MKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQE
VRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccctatgatctgaccgtatccgtgaccccgcgttatgtgccggagcagtccgat
cccagtcagcagcaatacgtgtttgcctacacggtgcgcatcaccaataccggttcgcac
ccggcccaggtcatcagccgccactggatcatcaccgacggcgaggagcgcgtgcaggaa
gtgcgcggccttggcgtggtgggccagcaaccgctgctggcgccgggcgagaccttcgaa
tacaccagcggctgtccgcttccgacccccatcggcacgatgcggggtacctaccattgc
gtcggcgaaaacggcattccgttcgaggtgccgatcgcggagttcctgctggccatgccg
cgtacactgcactga

DBGET integrated database retrieval system