KEGG   Borreliella burgdorferi N40: BbuN40_0561Help
Entry
BbuN40_0561       CDS       T02075                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bbn  Borreliella burgdorferi N40
Pathway
bbn00030  Pentose phosphate pathway
bbn00480  Glutathione metabolism
bbn01100  Metabolic pathways
bbn01110  Biosynthesis of secondary metabolites
bbn01120  Microbial metabolism in diverse environments
bbn01130  Biosynthesis of antibiotics
bbn01200  Carbon metabolism
Module
bbn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BbuN40_0561 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BbuN40_0561 (gnd)
Enzymes [BR:bbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BbuN40_0561 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BbuN40_0561 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_Gly3P_dh_N F420_oxidored 3HCDH_N ApbA IlvN Shikimate_DH 2-Hacid_dh_C PDH PepSY_like NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: ADQ29267
Position
572545..573939
Genome map
AA seq 464 aa AA seqDB search
MDVGIYGLGVMGSNLALNIADNGFNVSVYNRDNEKTEIFVKQNSHKKINGFKDVESFIKS
LKAPKKVILMVTSSAIEKVIEQILPFMNKSDIIIDGGNSHYKSTMRLEKELFAKDIYFVG
LGISGGERGARFGPALMYGGSKSAYEILEPMLNKIAAKTKNNDICSTYIGENGSGHYVKM
IHNGVEYADMQLISEVYFFMKKAFNLDNLKISEVFEKWNEGDLSGYLLEITSKILKYKEN
NEYLVDKILDIANQKGTGVWTSIDALESGMPVNVIVESVFSRFMSGLKHERIIASDLLKM
DTSSFEFELSDWILDLYYALLVSKIVAYAQGFMMLKTASVNYGWDLNLGKISLVWREGCI
IRSSFLDKIKLAYDKNPHLINLLFDDYFLDLLKNNHKSLRRIISKASEIGIPLPAFYASL
SFLDSYSTNYLPSNLIQAQRDFFGAHSFERLDSKRGEFFHSAWQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaggaatttatggacttggtgttatgggtagtaatttagctctaaatattgct
gataacggttttaatgtttctgtttacaatagagataatgaaaaaactgaaatttttgtt
aaacaaaattctcataaaaagataaatggttttaaagatgttgaatcttttattaaaagc
ttgaaagctccaaaaaaagtcatcttaatggtgacaagttccgctatagaaaaggttatt
gagcaaattttgccctttatgaataaatcagacataattattgatggtggaaattctcat
tataagagcacaatgagattggaaaaagaattgtttgctaaagacatttattttgtagga
cttggaatttccgggggggagagaggagcaagatttggtcctgcgctaatgtatggagga
agtaaatcagcctatgaaattcttgagcccatgttaaataaaattgcagctaaaaccaaa
aataatgatatttgttcgacttatattggggagaacggttctgggcactatgttaaaatg
atacataatggagtggaatacgctgatatgcagcttatcagcgaggtttattttttcatg
aaaaaagctttcaatttggataatttgaaaatttctgaagtttttgaaaaatggaatgaa
ggcgatctttcagggtatttactagaaataacttctaagattcttaaatataaagaaaat
aatgaatatttagttgataagattttagatattgcaaatcaaaaaggcactggtgtttgg
acatctattgatgctcttgaatctggtatgcctgtaaatgtaattgttgaatctgttttt
tcaagatttatgtcggggttaaaacacgaaaggattattgctagcgatttacttaagatg
gatacttcttcttttgagtttgagcttagtgattggattttagatctttattatgctctt
ttagtttcaaaaatagtagcttatgctcaaggttttatgatgcttaagaccgcgtctgtg
aattatggttgggatttgaatttaggtaaaatttctttggtttggagagaaggctgtatt
attcgtagcagttttttagataaaattaaattggcttatgataaaaatcctcatcttatt
aatttgctttttgatgattattttttagatttactaaaaaataatcacaaatctttaaga
agaataatttcaaaggctagtgaaattgggattcctttgccagcattttatgccagcctt
tcgtttttagattcttattccactaattatctgccttctaatctaattcaagcacaaaga
gatttttttggcgcccattcttttgaaagattagactcaaaacgaggtgaattttttcat
agcgcttggcaataa

DBGET integrated database retrieval system