KEGG   Babesia bovis: BBOV_I001970Help
Entry
BBOV_I001970      CDS       T01085                                 

Gene name
19.m02057
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bbo  Babesia bovis
Pathway
bbo00450  Selenocompound metabolism
bbo00970  Aminoacyl-tRNA biosynthesis
bbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBOV_I001970 (19.m02057)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBOV_I001970 (19.m02057)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbo01007]
    BBOV_I001970 (19.m02057)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbo03016]
    BBOV_I001970 (19.m02057)
Enzymes [BR:bbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBOV_I001970 (19.m02057)
Amino acid related enzymes [BR:bbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBOV_I001970 (19.m02057)
Transfer RNA biogenesis [BR:bbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBOV_I001970 (19.m02057)
 Prokaryotic type
   Other AARSs
    BBOV_I001970 (19.m02057)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 5477065
NCBI-ProteinID: XP_001608849
UniProt: A7AW53
Position
1
AA seq 534 aa AA seqDB search
METSRSHVNGNGALKSLSDVSRDLIGKKYYITTALSYTNGPPHIGHTYEIVTSDIISRFF
KVFGMVPILLSGTDEHGLKVATTAESYGMFPIELADYYSAKFHDNNTDLLTATHIFVRTT
EPRHYKSAQKIWRILRDRGDIYLGEYSGWYNVREETFLTEVEAAATDYKDPLSGKPYTLM
KESSYFFRMSKYQDMLIEKLSSDPAYLQPDSARAEILSRLKKPLEDLSVSRCNFKWGIPV
PDDPSHVMYVWSDALTGYLSGIGFGDFDDISQLKLWPPDLQVIGKDIIWFFAVIWTSILM
SLEVPLPKTIFAHGFITAADGRKMSKSLGNVVNTKELLDKYGVDTLRYYMIRDSVFGSDV
KFDLSSLADLHNSDLTDTIGNLLHRITTLCVKFSNGCIPPLASKSAPRPFCMVDVARRTL
SHLQRFALQDALVTVIEAYRDTNKYLTDREPWAKGSVDTRLDTIRNVLEAIYFLNHLMEP
VIPLASSVVFKKLGTEKRDHIGFLSSDYDNLTEGTKVVVGDILFQKVETSAKIT
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatctagaagtcacgtgaatggcaatggcgcattaaaaagtttatctgacgtc
tctagagatttaattggaaagaaatattatatcactactgctctttcatacacaaatgga
cctcctcatatcggacacacgtatgagatcgttacctctgacattatttcacgtttcttt
aaggtttttggtatggtaccaatccttttatcaggtaccgatgagcatggactgaaggtt
gccacaacagccgaaagctacggaatgtttcctattgaactagccgattattattcagca
aagtttcacgacaacaatactgacttgcttacagccacgcatatttttgtgagaactacg
gagccacgtcattataaatcagcgcaaaaaatttggcgtattcttcgagaccgtggtgat
atttatctaggtgaatacagtggttggtataatgttcgtgaagagacatttctaacggaa
gtcgaagccgctgctactgactataaagaccccttatccggcaaaccatatactttaatg
aaagaatccagctatttcttccgtatgagcaaatatcaagatatgttaattgaaaagctt
agcagtgatcctgcttatttgcaaccagactcagcaagggctgaaattctaagtcgtctt
aaaaagcctttggaagacttatcagtcagccgttgcaattttaaatggggaataccggta
ccagatgacccttcccatgtaatgtatgtatggtccgatgcattgacgggttatctgagc
ggcattggttttggtgactttgacgatatatcccaactgaaactctggcctccagactta
caggtcattggaaaagacatcatatggttttttgctgtgatatggacatctattttgatg
tctttggaggttccgctacccaaaaccatatttgcacacgggttcatcactgctgccgat
gggcggaagatgagcaaatctcttgggaatgttgtcaacaccaaagaattgcttgataag
tatggtgttgatacattacgatattatatgattcgtgactctgtctttggatctgacgtc
aagtttgacctttcgtcattggccgatcttcacaacagcgatcttacggatactataggg
aacctcttacaccgcattactactttatgcgtaaagttttctaatgggtgtattccgcca
ctagcttcaaagtcagctcctcgcccattttgcatggtagatgtcgccaggaggacttta
agtcatttacaacgttttgcccttcaggatgcattagtaacagtgattgaggcttataga
gacacgaacaagtatctcaccgatcgtgaaccatgggcaaaaggatccgtcgatacacgc
ttagacactatacgcaacgtgcttgaggcgatatatttcttaaaccacttaatggaacca
gttattccattggcttccagtgtggtatttaaaaagttaggcaccgaaaagcgagatcat
ataggatttttatcgtctgattacgacaacttgacggagggaactaaggttgtggtaggg
gacattttgttccagaaggtagagacgtcggcgaaaatcacatag

DBGET integrated database retrieval system