KEGG   Babesia bovis: BBOV_I002330Help
Entry
BBOV_I002330      CDS       T01085                                 

Gene name
19.m02062
Definition
(RefSeq) flavodoxin and oxidoreductase NAD-binding domain containing protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bbo  Babesia bovis
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBOV_I002330 (19.m02062)
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BBOV_I002330 (19.m02062)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_1 NAD_binding_1 FAD_binding_1 FAD_binding_6 gerPA
Motif
Other DBs
NCBI-GeneID: 5477099
NCBI-ProteinID: XP_001608883
UniProt: A7AW87
Position
1
AA seq 661 aa AA seqDB search
MIITSTVLFYVAYYVWNSNSESTDDANKKENDNETNNNTTEKASNTNIEADNADVSKKIV
VYYGSQTGTAERFAKTLAHRLADWNSIFQRSSVNLEEFDEHDLLRPNTIAIFLIATHDDG
HFPDNAERFVRWLRLMEDESKRLECLEYCIFGLGSTEYPQFNNASKNLNNILINLGAKAL
LPIKLGDDATDLKSDFEEWSRDVCNALAKRLVIEPVSETFYEKPLLVSLKETWRDCVPLE
LRYLSKDQIKSDCTPISATVVCKQQWQCVDHVVIDNINMTPESEETTNMLTIESYGEFNA
AETINVLYANPPKVVSYFMDKLNIKEQDMEKLITFVPRYATVDTQMNFEAPFPIPCTIGD
ALRYYLDLTGLPDEETLRNLGTFLQSNHSCQYLNKLFKRKALMKIMKEELHLTLQEFIEI
FMHDAIFNIGGFLQIIPKKVTKAYTVSSHPKTNKIDLTIKLVKKRNFTFKTFKSRIQKEI
GYEVRPGTEKMFALHRMYKGACTHYLCSLQKGDVVKLYKRPSAFSLISDIFDKPLVMIAN
GSGIAPFRALWQQGNTTHRRIIFFGFRDEQHILYKEEIEGLKNMPNYSVNIALSRTGKHE
YVQHILRNHIIQVQDILNSSGLIYVCGSKAMGAQVKAMLQHFLKIDIAVLKTQQKYVEEL
W
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgattataacgtccacggttttgttttacgttgcgtattacgtctggaatagtaacagc
gaaagcacagatgacgcgaacaaaaaagagaacgataatgaaactaacaataataccact
gagaaagcctcaaatacgaatatagaagcggataatgccgatgtgtcgaagaaaatagtc
gtatactatggcagtcaaaccggtacagcagagagattcgccaaaacccttgcacatcgg
ctagcagactggaactcaatattccaaagatctagcgtcaatctagaggaattcgatgaa
cacgatctactccgccctaataccatcgccatatttctaatagcaacgcatgatgatgga
cactttccagacaatgctgaaagatttgtaagatggctaaggttaatggaagacgaatcc
aaaagactggaatgtcttgaatattgtatcttcggactgggtagcactgagtatcctcag
tttaataatgcatccaaaaatctcaacaatatattgatcaatctgggtgccaaagcactt
ttaccaataaaattgggtgacgatgcaaccgatttaaaaagtgactttgaagaatggtca
cgagatgtatgcaatgccttggcaaaaaggctcgtgatagagcctgtttcagaaacattt
tacgaaaaaccattactcgtaagcctaaaagaaacctggagggattgcgtgccgttagag
ttaagatatctgtccaaagatcagataaagagcgattgtacacccataagtgctactgtt
gtatgcaagcagcaatggcaatgtgtagatcatgtggttatcgataacatcaatatgaca
ccagaaagtgaagagacgacaaatatgctaacaatcgaatcatatggtgaattcaatgca
gctgaaacgataaacgtattgtatgcaaatcctcctaaggttgtatcgtatttcatggat
aaactaaatataaaagaacaagatatggaaaagctcatcacatttgtaccgagatatgca
acagtagacacacaaatgaactttgaagccccgttcccaataccatgcacaattggtgat
gcattgcgttattatttggacctcacgggattgccggatgaagaaacgttacgtaacttg
gggacattcttgcaaagcaaccactcatgtcaatacctcaataaactcttcaagagaaaa
gctttgatgaaaataatgaaagaggaattgcacttgacgctgcaagagtttattgaaatt
tttatgcatgatgcaatattcaacattggaggctttttacaaattatacccaagaaggta
acaaaagcatatactgtatcttcccatccaaagacaaacaagattgatttaacaataaaa
cttgttaagaaaaggaattttactttcaaaacattcaaatcgagaattcaaaaggagatc
ggctacgaagtaaggccaggcacggaaaaaatgttcgctttgcatcgcatgtataaagga
gcttgtactcattatttgtgttcgctccaaaagggggatgtagtaaaactatacaagaga
ccatctgctttcagcctaatcagcgatatattcgataagccattggtcatgatagcaaac
gggtcaggcatcgcaccattcagagcattgtggcaacaggggaacacaacgcaccgacgc
ataatattcttcggtttcagagatgagcaacatatcttgtataaggaagaaattgaaggt
ttaaagaacatgccgaactacagtgtaaacatcgcactttctagaaccggaaagcacgaa
tacgtacaacatatattacgaaaccacattatccaagtgcaagatattctaaactcaagc
ggattgatatacgtgtgtgggagcaaagccatgggtgcccaggtcaaagcaatgcttcaa
cattttctgaagattgacattgctgtgctaaaaacgcaacaaaaatatgtcgaagaactt
tggtag

DBGET integrated database retrieval system