KEGG   Babesia bovis: BBOV_I004080
Entry
BBOV_I004080      CDS       T01085                                 

Gene name
19.m02335
Definition
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
bbo  Babesia bovis
Pathway
bbo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    BBOV_I004080 (19.m02335)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbo01009]
    BBOV_I004080 (19.m02335)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbo04131]
    BBOV_I004080 (19.m02335)
   03036 Chromosome and associated proteins [BR:bbo03036]
    BBOV_I004080 (19.m02335)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbo04147]
    BBOV_I004080 (19.m02335)
Protein phosphatases and associated proteins [BR:bbo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     BBOV_I004080 (19.m02335)
Membrane trafficking [BR:bbo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    BBOV_I004080 (19.m02335)
Chromosome and associated proteins [BR:bbo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     BBOV_I004080 (19.m02335)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBOV_I004080 (19.m02335)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg Dockerin_1 EF-hand_11 Caleosin UPF0154 EFhand_Ca_insen DUF5580 Fe_hyd_lg_C Sigma54_CBD MotA_activ
Other DBs
NCBI-GeneID: 5477273
NCBI-ProteinID: XP_001609057
UniProt: A7AWR1
Position
1
AA seq 149 aa
MADQLSEEQIAEFKEAFSLFDRDGDGSITTKELGTVMRSLGQNPTEAELADMINDIDTSG
TGAIDFPEFLILMARKMKEGDTEEELVQAFKVFDRDGNGFISAQELRHVMTNLGEKLTNE
EVEEMLREADVDGDGKINYEEFVKLMISK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagatcagttgagcgaggagcaaattgccgagtttaaagaggccttctctttgttc
gacagagatggcgatggcagcatcacaacaaaggagctgggaactgtcatgcgttcactt
ggacagaatccaacggaagctgaactagctgatatgatcaatgacatcgacaccagtgga
acgggtgccatcgacttccctgaattcctgatactcatggccaggaaaatgaaagagggt
gacaccgaagaggaactggttcaagcgtttaaggtatttgacagagatggcaatgggttt
ataagtgctcaagaacttagacatgttatgactaacctcggagaaaagctcacaaatgag
gaagtcgaggaaatgctacgcgaagcggatgtcgatggtgatggaaagatcaactacgaa
gagttcgtaaagctcatgatttccaaataa

DBGET integrated database retrieval system