KEGG   Babesia bovis: BBOV_II006040Help
Entry
BBOV_II006040     CDS       T01085                                 

Gene name
18.m06502
Definition
(RefSeq) nucleolar protein NOP5
  KO
K14565  nucleolar protein 58
Organism
bbo  Babesia bovis
Pathway
bbo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    BBOV_II006040 (18.m06502)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bbo03009]
    BBOV_II006040 (18.m06502)
Ribosome biogenesis [BR:bbo03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    BBOV_II006040 (18.m06502)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 5478356
NCBI-ProteinID: XP_001610122
UniProt: A7AUE3
Position
2
AA seq 439 aa AA seqDB search
MLVLLETSAGYGLFKITDSRLLECSVDEVPSFFQDGDTARSSVKLSAFSKFNTTDDALEE
ATALSESRLGKQLKRLLKKKVVEAKIVEPLGVCDKSLAIEIQKKLKIDVVYNPNTLEIAR
GLKGQFFELVSGISESDARSMSLSLSHSLARFKLKFSPDKVDIMVVQAIGLLDDLDREAN
NFGMRLKEWYGWHFPELSHIVPDMTLYSRAVRQIGIRGSTSLDELESFLPKDVVDEIKKA
CEISMGSELMTDDLEAINELAERLEEMLNYRSTLEEYLRMRMRALAPNLTHMVGEVIGAR
LLSHSGSLINLAKHPASTVQILGAEKALFRALKTNAPTPKYGIIYHAGFVGQAQPKHKGK
ISRILAAKLALCVRVDALQDSQEPTVAIESKRYLEQKLLELSGKPDITNTGGMKRPEKPG
QLQKPKWSSAKRFKQNESE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgcttttagagacatcggccggttatggcctattcaagattacagattctcgc
ttgctcgaatgcagcgtcgatgaagtcccttcgttttttcaagacggcgacaccgcccgt
tcatcggtaaaattatcagccttttccaaatttaacactactgacgatgctcttgaagag
gctacggcgttgtctgagtcacgtttgggcaagcagctcaagcgtttgctaaaaaagaaa
gtagtcgaggctaaaatagtagagccattaggtgtttgtgacaagagtctggctattgaa
attcagaagaaattgaagattgatgttgtgtacaaccctaatacgctggagatcgctcgt
ggcctcaagggccagttttttgaattggtgtcaggtatttcggaatcggatgccagatct
atgtctttgagtttatcgcattctttggctcggttcaagctgaaattttcacctgacaag
gtggatataatggtcgttcaagccatcggtcttcttgacgaccttgaccgcgaagcaaac
aactttggcatgcgactgaaggaatggtacggttggcatttccccgagttatctcacatt
gttccggacatgacgttatattctcgcgctgtacgtcagattggcatccgcgggtcaaca
tcactagatgagttggagtcatttctcccaaaggatgttgtcgatgagataaagaaagca
tgtgaaatttccatgggttctgagctgatgactgatgatttggaggctattaatgaattg
gcagagcgtctggaagagatgcttaactaccgttctactttggaggagtaccttcgtatg
cgtatgcgcgccttggctcctaacctaactcacatggttggtgaggtgattggtgcgcgg
ctgttatctcacagtggttctttaataaacttggctaagcatcctgcatctactgtgcag
atccttggtgccgagaaggctctgtttagggctctgaagacgaatgctcctacacctaaa
tatggcattatctaccatgctgggtttgtaggccaagctcaacctaaacacaagggtaag
atatcacgcattctggcggcaaaactggctttatgtgttcgtgttgatgccttgcaagat
agtcaagaacctacagtggcgatcgagagcaagcgttaccttgaacagaaattactggag
ctttcaggaaagcctgatataacgaataccggtggtatgaagcgcccagagaagcctggg
cagttacagaaacccaaatggagttctgctaagcgctttaagcaaaacgaatcagagtga

DBGET integrated database retrieval system