KEGG   Babesia bovis: BBOV_III007860Help
Entry
BBOV_III007860    CDS       T01085                                 

Gene name
17.m07690
Definition
(RefSeq) phosphoglycerate mutase 1 family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbo  Babesia bovis
Pathway
bbo00010  Glycolysis / Gluconeogenesis
bbo00260  Glycine, serine and threonine metabolism
bbo01100  Metabolic pathways
bbo01110  Biosynthesis of secondary metabolites
bbo01130  Biosynthesis of antibiotics
bbo01200  Carbon metabolism
bbo01230  Biosynthesis of amino acids
Module
bbo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBOV_III007860 (17.m07690)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBOV_III007860 (17.m07690)
Enzymes [BR:bbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBOV_III007860 (17.m07690)
Membrane trafficking [BR:bbo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBOV_III007860 (17.m07690)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBOV_III007860 (17.m07690)
  Exosomal proteins of melanoma cells
   BBOV_III007860 (17.m07690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Exc
Motif
Other DBs
NCBI-GeneID: 5480166
NCBI-ProteinID: XP_001611914
UniProt: A7AP62
Position
3
AA seq 248 aa AA seqDB search
MMTLVVIRHGESAWNLENRFCGWVNQPLTKCGENEAREGGEALKREGLTFGVLFTSVLDR
AIKTADIVLDILGQTGIPTFRSWRLNERHYGALQGLNKVETVEKYSLEQVNLWRRSYDVP
PPPCETTSEYYPGNDPKYADIPRDEIPNGESLEHCVKRVKPYWENDILPMLKKGEPVLIV
SHGNAIRSLMKLFDTTNEDVTKLNLPNGVPLVYKFSEDMKVVEKKFLLSEEELKARMEKI
ANQVIKNN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccttgtcgtgattcgccatggcgagagcgcatggaacttggaaaaccgcttt
tgcggttgggttaaccagcctttgacaaagtgtggtgagaatgaggctagggagggtggt
gaagctttgaagagggaaggcttgacttttggtgttcttttcacttcagttcttgaccgt
gccataaagactgctgacattgttcttgacattcttggtcagactggcattcctactttc
aggagttggcgcctaaatgagcgccactacggtgctcttcagggtcttaataaggttgag
actgtggagaagtactctttagagcaggttaacctttggaggcgttcttacgacgttcct
ccaccaccatgtgagactactagtgagtattaccctggtaacgaccccaagtacgccgat
atccctcgtgacgaaatccctaatggagagagtcttgagcactgtgttaagcgtgtgaag
ccttactgggagaacgacattttgccaatgctcaagaagggcgagccagtactgatagtc
tctcacggaaatgctatccgttctcttatgaagttgtttgacactaccaacgaggacgtc
actaagttgaatttgcctaatggtgttccattggtatacaagttttctgaggatatgaag
gtggttgagaagaagttccttctttctgaggaggagcttaaggctcgcatggagaagatt
gcaaaccaggtcatcaagaacaactga

DBGET integrated database retrieval system