KEGG   Babesia bovis: BBOV_IV006630Help
Entry
BBOV_IV006630     CDS       T01085                                 

Gene name
23.m05807
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bbo  Babesia bovis
Pathway
bbo00450  Selenocompound metabolism
bbo00970  Aminoacyl-tRNA biosynthesis
bbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBOV_IV006630 (23.m05807)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBOV_IV006630 (23.m05807)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbo01007]
    BBOV_IV006630 (23.m05807)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbo03016]
    BBOV_IV006630 (23.m05807)
Enzymes [BR:bbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBOV_IV006630 (23.m05807)
Amino acid related enzymes [BR:bbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBOV_IV006630 (23.m05807)
Transfer RNA biogenesis [BR:bbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBOV_IV006630 (23.m05807)
 Prokaryotic type
   Other AARSs
    BBOV_IV006630 (23.m05807)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e POTRA
Motif
Other DBs
NCBI-GeneID: 5478821
NCBI-ProteinID: XP_001610587
UniProt: A7AR50
Position
4
AA seq 522 aa AA seqDB search
MDRLCTPVGVYKTKDHIRHGFAINESSGQPYELGATLLTTPLFYLNDPLHVGHAYTLVSA
DAIKKYYKLLGRTILILSGTDEHGTKIANAAQTNGEKPEIFIERMRQHYTDVYEAYDVSV
DINVHTSLEQHKEKVKKTFGYLLEKGDIYEGVHKGYFSPTEETYYTEFQLINGKSPLGFD
VYPVAEKAYFFRLSKYKDALLQLIKREGFIVPKERQNEAIGLLSGNLPDIAITRSNTTWG
VPVGQPGFEGHTIYVWLDALLGYCIDRNQYGVGTETLMLFGKDILRFMTLVWPALLMALE
MPMPQQMVCHGWLMSNDEKISKSKGDKVFALPPIGTSDVSRFVLMNLGAFGEDIQYNPKR
VEDMKNIVRDKYANLTYRLTGMIDKRGILEINHRDTECINHFVEGITKKWECLQNIMEHH
RIDKYVNEVTEVAGCINSYITHKQVWDLHDEDEFQSHALAICQSLLVLSAYIYPIMPQLT
RMNIERLQPEINGTPIKISTMAKLLDTLHMVDFRPQHLCPLT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaccggttgtgcaccccggtaggtgtatataaaacaaaggatcatatcaggcatgga
tttgcaataaatgaatccagtggacagccttatgaacttggagctacattgctaacgaca
cctcttttctatctcaatgacccattacacgtaggtcatgcgtataccctagtatcagcg
gatgccattaagaagtactataagctattggggaggactatcctgattctttccggaacc
gatgaacatggaaccaagatagcaaatgcagcacagacaaatggtgaaaagcctgagatc
tttatcgagcgtatgaggcaacattacacagatgtctatgaagcctacgacgtgagtgtg
gatatcaacgttcatacatccctcgaacaacacaaagaaaaggttaagaaaacttttgga
tacctactcgaaaagggtgatatatacgaaggcgtacacaaaggatacttctcaccaaca
gaggagacttattataccgaatttcaactaattaatggaaagtcacccttaggttttgac
gtatacccagttgctgaaaaagcatacttttttagactgtccaaatataaagatgcattg
ctgcagttgattaaacgggagggttttatagtaccaaaagaacggcaaaacgaagcaatt
ggtctcctcagtggtaatctaccagacatagctatcacaaggtcaaatacaacttgggga
gtgccggtaggtcaaccaggttttgaagggcatacgatatacgtttggttagatgcatta
ttgggatactgtatcgacagaaatcaatatggagttggtactgagactttgatgcttttc
ggaaaggatatcttgcgatttatgaccttggtatggcctgcactcctgatggcactagag
atgccaatgccacaacagatggtctgtcacggttggttaatgagcaacgatgaaaaaata
tcaaagtcaaaaggtgataaagtattcgcgctaccgccaattggaacgtcagatgtatcg
agatttgtcctgatgaacctaggtgcatttggcgaagacatccaatataatcctaaaagg
gtagaggacatgaagaacattgtaagggacaagtacgccaatttaacttacaggctaact
ggcatgatagacaaaaggggtattttggaaatcaaccaccgtgatacagagtgtataaac
cactttgttgagggtattaccaagaagtgggagtgtttgcaaaatattatggaacatcat
agaatcgacaaatacgtcaacgaagtaactgaggtggcaggttgcatcaatagctacatc
acgcataaacaagtttgggacttacatgatgaggatgaattccaaagtcatgcacttgcc
atatgccaatcattactcgtgcttagtgcgtatatatatccaataatgccacagttgaca
cggatgaacatcgaaaggctgcaaccagaaattaacggtacaccgataaaaatttctaca
atggcaaaattgctagacactctgcatatggtagattttagaccacagcacttgtgcccc
ttaacgtag

DBGET integrated database retrieval system