KEGG   Bifidobacterium bifidum PRL2010: BBPR_0934Help
Entry
BBPR_0934         CDS       T01340                                 

Gene name
metF
Definition
(RefSeq) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00670  One carbon pool by folate
bbp01100  Metabolic pathways
bbp01120  Microbial metabolism in diverse environments
bbp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BBPR_0934 (metF)
Enzymes [BR:bbp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BBPR_0934 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 9889076
NCBI-ProteinID: YP_003971048
UniProt: A0A0H3EA59
Position
1114531..1115379
Genome map
AA seq 282 aa AA seqDB search
MHTPMFSLEVFPPKRDAPVGTIYDTLDGLEGLNPDFISVTYGHGTHSDRTATARIANTIH
GEYGIPAVAHLTALYSDEAKIDEALDMFEAAGVSAVLALRGDYIDGEEPVGRFNHASDLA
TYIHDRKPGLKVFGACYPEGHYSAASLDEDIGNLKIKVDAGVTHLISQLFYDNDDFYRFL
DKAHAAGIDVPIEAGIMPVRGAKSVRRMAKVNASRIPAKLEALLDRWGDDIQNLRAAGII
YASDQIADLVAHGVDGVHLYSMNHPATTRRIWRNVEPLFTVE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcacacacccatgttttcgctggaggtgttccctcccaagcgggacgcccccgtcggg
accatctacgacacgcttgacggactcgaaggcctgaaccccgacttcatctcggtcacc
tacgggcacggcacgcattcggatcgcaccgccaccgcgcgcatcgccaacacgatccac
ggggaatacggcatccctgccgtggcgcatctgaccgccctgtactcggacgaggcgaag
atcgacgaggcgctcgacatgttcgaggcggcaggcgtctccgccgtgctcgccctgcgc
ggcgactacatcgacggcgaggagccggtcggtcgcttcaaccacgccagcgacctcgcg
acctacatccacgaccgcaagcccggcctcaaggtgttcggcgcctgctatcctgaaggc
cactattcggccgcctcgctcgacgaggacatcgggaacctgaaaatcaaggtggacgcc
ggcgtcacgcatctgatctcccagctgttctacgacaacgacgacttctaccgtttcctc
gacaaggctcatgcggccggcatcgacgtgccgatcgaggcgggcatcatgcccgtgcgc
ggcgcgaagtcggtgcggcgcatggcgaaggtcaatgcctcgcgcatcccggctaagctc
gaagcactgctcgaccgctggggagacgacatccagaacctgcgcgcggccggcatcatc
tacgcctccgaccagatcgcggacctcgtggcccacggcgtcgacggcgtgcacctgtat
tcgatgaatcatcccgccaccacacgccgcatatggcgcaacgtggagccgctgttcacc
gtggaatga

DBGET integrated database retrieval system