KEGG   Bifidobacterium bifidum PRL2010: BBPR_1000Help
Entry
BBPR_1000         CDS       T01340                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00260  Glycine, serine and threonine metabolism
bbp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbp01100  Metabolic pathways
bbp01110  Biosynthesis of secondary metabolites
bbp01130  Biosynthesis of antibiotics
bbp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1000 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBPR_1000 (trpA)
Enzymes [BR:bbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBPR_1000 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB
Motif
Other DBs
NCBI-GeneID: 9889136
NCBI-ProteinID: YP_003971107
UniProt: A0A0H3ECS8
Position
complement(1174590..1175468)
Genome map
AA seq 292 aa AA seqDB search
MIMTNTATTPSGQPLGISHKPSATEAMFDRLKAENKPAFIGYLPYGFPNPDISLDALRIM
VEHGVDAVEIGLPYSDPVMDGPVIQAASQIALNNGESINGVFKAVETVANAGGVPLIMSY
WNLIYHYGVERFACDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSASER
LELVARNARGFVYAASRMGVTGERDTISASPETLVERARNAGARNVCVGIGVSTPEQGAK
VGAYADGVIVGSALVHTLLDDDNVTAKTPKEGLRDLAAKVEALSEGIHNESR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgacgaatacagcaaccacaccgtccggacagccgctcggcatcagtcacaag
cccagcgcgacggaagccatgttcgaccggctcaaggccgagaacaagccggccttcatc
ggatacctgccgtatggcttcccgaaccccgacatctcactcgacgcgctcaggatcatg
gtcgagcacggcgtcgacgcggtcgagatcggcctgccgtactccgacccggtgatggac
ggtcccgtcatccaggcggccagccagatcgccctgaataacggggaaagcatcaacggc
gtgttcaaggcggtcgagacggtggccaacgccggcggcgtgccactcatcatgagctac
tggaacctgatctaccattacggcgtcgaacggttcgcctgcgatttcgagaacgccggc
ggtgccggcctgattacccccgacctcatccccgatgaggctggcgagtggatcgaggct
tcggatcgtcacggactcgaccgcatcttcctggtctccccggattcggcctccgaacgt
ctcgaactggtcgcccgcaacgcacgcggcttcgtctacgcggcatcccgtatgggcgtt
accggcgagcgcgacaccatcagcgcatcgcccgaaacgcttgtcgagcgtgcccgcaac
gccggggcgagaaacgtgtgcgtgggtatcggcgtatccaccccggagcagggcgcgaag
gtcggcgcctacgccgacggcgtcatcgtcggttctgctctggtgcacaccctgcttgac
gacgacaacgtcaccgcgaaaacgccgaaggaaggactgcgcgacctggccgccaaggtc
gaggcgctgtccgagggcatccacaacgagtcacgctga

DBGET integrated database retrieval system