KEGG   Bifidobacterium bifidum PRL2010: BBPR_1088Help
Entry
BBPR_1088         CDS       T01340                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00010  Glycolysis / Gluconeogenesis
bbp00260  Glycine, serine and threonine metabolism
bbp00680  Methane metabolism
bbp01100  Metabolic pathways
bbp01110  Biosynthesis of secondary metabolites
bbp01120  Microbial metabolism in diverse environments
bbp01130  Biosynthesis of antibiotics
bbp01200  Carbon metabolism
bbp01230  Biosynthesis of amino acids
Module
bbp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_1088
  Energy metabolism
   00680 Methane metabolism
    BBPR_1088
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1088
Enzymes [BR:bbp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBPR_1088
Membrane trafficking [BR:bbp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBPR_1088
Exosome [BR:bbp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBPR_1088
  Exosomal proteins of melanoma cells
   BBPR_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9889226
NCBI-ProteinID: YP_003971191
UniProt: A0A0H3ED10
Position
complement(1282354..1283190)
Genome map
AA seq 278 aa AA seqDB search
MIDEVVFLRHGRTAFNVARRLQGQIDVPLDIIGQWQADQSASELARRYYWAKVANIARHP
DTLAQPGPGAAKSSDIEEYRQVPASSRRMVVVSSDLFRALQTAHAFADMLGLDVTADARL
RERSFGQWEGMTRDEIRAEHADAYDSWRVHTGGELAFGVESRTATGLRGADAVLDLVRGI
NAEHADEPTTLMLVGHGSWHVATIETLLGMDPDNLSNLDGMRNAFWSTLRPVYRPSGGVE
WMMTAFNQGPAVAALCDWENGPQSLHGPHMPMWKPIEG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgaagtggtgtttctgcggcacggacggaccgccttcaatgtggcgaggcgg
ttgcaggggcagatcgacgtgcccctcgacatcatcggccagtggcaggccgaccagagc
gcgtcggagcttgcgcgacgctactactgggcgaaggtggccaacatcgcccggcatccg
gatacgctggcccagccggggccgggggcggcgaaatccagcgacatcgaggaataccgg
caggtccccgcatcctcgcgacgcatggtcgtcgtctcgtccgacctgttccgcgcgttg
cagaccgcgcacgcgttcgccgatatgctggggctggacgtgaccgcggacgcgcgcctg
cgcgaacgcagcttcgggcagtgggagggcatgacccgcgacgagattcgagcggagcat
gccgacgcctatgattcgtggcgggtccacaccggcggcgagctcgcgttcggcgtggag
agccgcaccgccacaggactgcgcggcgccgatgcggtgctcgacttggtgcgcggcatc
aacgcggagcatgccgatgagccgaccaccctgatgctcgtcgggcacggctcatggcat
gtggccacgatcgagaccctgctcggcatggaccccgacaacttgagcaacctggatggc
atgcgcaacgcgttctggtcgacgctcagaccggtataccggccttcgggcggcgtcgaa
tggatgatgacggcgttcaaccaggggccggcggtcgctgctctgtgcgattgggagaac
ggcccgcagtccctgcacggcccgcacatgccgatgtggaagccgatcgaggggtga

DBGET integrated database retrieval system