KEGG   Bifidobacterium bifidum PRL2010: BBPR_1416Help
Entry
BBPR_1416         CDS       T01340                                 

Gene name
glk
Definition
(RefSeq) glucokinase/xylose repressor Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00010  Glycolysis / Gluconeogenesis
bbp00052  Galactose metabolism
bbp00500  Starch and sucrose metabolism
bbp00520  Amino sugar and nucleotide sugar metabolism
bbp00521  Streptomycin biosynthesis
bbp01100  Metabolic pathways
bbp01110  Biosynthesis of secondary metabolites
bbp01120  Microbial metabolism in diverse environments
bbp01130  Biosynthesis of antibiotics
bbp01200  Carbon metabolism
Module
bbp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_1416 (glk)
   00052 Galactose metabolism
    BBPR_1416 (glk)
   00500 Starch and sucrose metabolism
    BBPR_1416 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_1416 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBPR_1416 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BBPR_1416 (glk)
Enzymes [BR:bbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBPR_1416 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase FtsA Glucokinase BcrAD_BadFG Hydant_A_N FGGY_N Kelch_1
Motif
Other DBs
NCBI-GeneID: 9889543
NCBI-ProteinID: YP_003971492
UniProt: A0A0H3EDP6
Position
1675124..1676074
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDAITHRWRVPTPMDADAINHHIANIYHEAVAAGHDDIQA
IGISAAGNVGADRRTLTFAANIPAWINYDLSEHIGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVIDGRLYRGSFGMAAELGHLPMVPDGDTCGCGLRGCAE
RYTSGSALERFAKSAVRRRPQDAERLMELCGGDVDKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRAMAATAAVLDPDVFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHASIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctagccattgatatcggaggaaccaaaatcgccgcagccgtatgcgatgaa
aacgatgccatcacacatcgctggcgcgttcccacaccgatggacgccgacgccatcaac
caccacatcgccaacatctaccatgaggccgtcgccgccggccacgacgacatccaggcc
atcggcatctccgcggccggcaacgtcggcgcggaccgccgcaccctcaccttcgccgcg
aacatccccgcgtggatcaactacgacctgtccgagcacatcggcgcgctcatcgaccat
gccgtgccggtcgtcgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgcgggccagggcagctcgaacatggtcgcgctgaccgtaggtaccggactgggcgga
gcaatcgtcatcgacgggcggctgtaccgcggatcgttcggcatggccgcggaactcgga
cacctgccgatggtgccggacggcgacacctgcggatgcgggcttcgcggctgcgcggaa
cgctacacgtctggaagcgcgctggaacggttcgccaagtccgccgtgcgccgacgcccg
caggacgccgaacgcctgatggagttgtgcggcggcgacgtcgacaagctcgaaggcccg
atggtctcgcaggccgcacaggagggcgacgtgctcggcctgtacgccttcggcaaaatc
ggcgaatggctcggccgcgcgatggccgccaccgccgcggtgctcgacccggacgtcttc
gtgatcggcggtggcgtagtggcggtcggcgacatcctgctggagccggcgcgatacaac
taccagcggttcctggagggcagcgcataccgtggccacgcgagcatcgtcgccgccacc
gccgggcaggacgccggcctgatcggcgccgccaacctggcactgcgctaa

DBGET integrated database retrieval system