KEGG   Bifidobacterium bifidum PRL2010: BBPR_1563Help
Entry
BBPR_1563         CDS       T01340                                 

Gene name
adh2
Definition
(RefSeq) aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00010  Glycolysis / Gluconeogenesis
bbp00071  Fatty acid degradation
bbp00350  Tyrosine metabolism
bbp00620  Pyruvate metabolism
bbp00625  Chloroalkane and chloroalkene degradation
bbp00626  Naphthalene degradation
bbp00650  Butanoate metabolism
bbp01100  Metabolic pathways
bbp01110  Biosynthesis of secondary metabolites
bbp01120  Microbial metabolism in diverse environments
bbp01130  Biosynthesis of antibiotics
bbp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_1563 (adh2)
   00620 Pyruvate metabolism
    BBPR_1563 (adh2)
   00650 Butanoate metabolism
    BBPR_1563 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    BBPR_1563 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBPR_1563 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBPR_1563 (adh2)
   00626 Naphthalene degradation
    BBPR_1563 (adh2)
Enzymes [BR:bbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBPR_1563 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BBPR_1563 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 9889687
NCBI-ProteinID: YP_003971629
UniProt: A0A0H3EBN5
Position
complement(1842493..1845225)
Genome map
AA seq 910 aa AA seqDB search
MAEATQVEAPAKPSPEEKRAAAEAEVDALVKKGLKALDEFEKLDQKQVDRIVAKASVAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTHYMAGQKTVGLIREDEVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLLALKTRCPIVFGFHPGAQKSSVAAAKIVRDAAIEAGAP
ENCVQWIEHPSIEATGALMKHPGIATILATGGPGMVKAAYSSGKPALGVGAGNAPAYIDT
DVDIERAANDLILSKHFDYGMICATEQAIIAHKDVYAPLVKELKRRKAYFVNADEKAKLE
QYMFGCTAGSGQKPVLNSVVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADDKEQAFEMCEKMLKLGAGHTAAIHTNNEALVREYGLRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMHGIEKAVIVCDKVMEQLGIVDKVIDQLRARDNRVTFRIIDYVEPEPSV
ETVERGAEMMREEFEPDTIIAVGGGSPMDAAKIMWLLYEHPEISFSDVREKFFDIRKRAF
RIPPLGEKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGAVPEEP
TSWPKYNKYVADKRYQDIARIIGIDPGKTPAEGVENLAKAVEDYRDNKLGMNKSFQDCGV
EEDYFWSVLDQIGMRAYEDQCTPANPRIPMIEDMKDIAVAAYYGVPQAEGHKIRVEREGV
AATEEASERV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcaacacaggtcgaggcgcccgccaagccgagccccgaggagaagcgcgcg
gcggccgaagccgaggtcgacgcccttgtcaagaagggtctcaaggcccttgacgagttc
gagaagctcgatcagaagcaggtcgaccgcatcgtcgccaaggcgtccgtcgcggccctg
aacaagcatctggtgctcgcgaagatggccgtcgatgagaccggccgtggtctcgtcgaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcactcactacatggccgggcag
aagaccgtcggcctgatccgcgaggacgaggtcatgggcatagacgaggtcgccgagccg
gtcggcgtcgtcgccggtgtcaccccggtcaccaacccgacctccaccgccatcttcaag
tcgctgctggcactcaagacccgctgtccgatcgtgttcggcttccacccgggcgcccag
aagtcgtccgtggccgccgcgaagatcgtccgcgacgccgcgatcgaagcaggcgcaccc
gagaactgcgtgcagtggatcgaacacccgtccatcgaggcgaccggcgcgctgatgaag
cacccgggcatcgccaccatcctggccaccggcggccccggcatggtcaaggccgcgtac
tcctccggcaagcccgccctcggcgtcggcgccggcaacgctccggcctacatcgatacc
gatgtggacatcgaacgtgcggcgaacgacctgatcctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgcgccgctcgtc
aaggagctcaagcgccgcaaggcatacttcgtcaacgcggacgagaaggcgaagctggag
cagtacatgttcggctgcaccgccggctccggccagaagccggtcctcaactccgtggtg
ccgggcaagtccccgcagttcatcgccaaggccgccggcttcgagatccccgccgacgcg
acgatcctcgccgccgaatgcaaggaggtctccgacgacgagccgctgacccacgagaag
ctcgccccggtgcaggccgtgctcaaggccgacgacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctcggtgccggccacaccgccgccatccacacgaacaacgaggcg
ctggtgcgcgagtacggcctgcgcatgcatgcctgccgcatcatctggaaccagccgagc
tcgctcggcggcatcggcgacatctacaacgcgattgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtccaggccgtgaacctgatcaacatc
aagcgcatcgctcggaggaacaataacatgcagtggttcaagattccggccaagacgtac
ttcgagccgaacgccatcaagtacctgcgcgacatgcacggcatcgagaaggccgtcatc
gtgtgcgacaaggtgatggagcagctcggcatcgtcgacaaggtcattgaccagctgcgc
gcccgtgacaatcgcgtcaccttccgaatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgagcgcggcgccgagatgatgcgcgaggagttcgagcccgacacgatcatc
gcggtcggtggcggctccccgatggacgcggccaagatcatgtggctgctctacgagcac
ccggaaatctccttctccgacgtgcgtgagaagttcttcgacatccgcaagcgcgcgttc
cgcatcccgccgctgggcgagaaggccaagctcgtgtgcatcccgacctcgtcgggcact
ggttcggaggtgacgccgttcgccgtgatcaccgaccacaagaccggatacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggcccgcacc
cagccgcgcaagctggcctccgacgccggtttcgacgccctgacccactccatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggccgagtccgtcaacggcgagccgggtctcgccaagaccgacgcg
caggagaagatgcacaacgccgccaccatggccggcatggcgttcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggcgccctgtgccacatcgcccacggccgc
accaactccatcctgctgccgtacgtgatccgctacaacggtgccgtcccggaggagccg
accagctggccgaagtacaacaagtacgtcgccgacaagcgctaccaggacatcgcccgc
atcatcggcatcgacccgggcaagaccccggccgaaggcgtcgagaacctggcgaaggcc
gtcgaggactaccgcgacaacaagctcggcatgaacaagtccttccaggactgcggcgtg
gaagaggactacttctggagcgtgctcgaccagatcggcatgcgcgcttacgaggaccag
tgcaccccggccaacccgcgcatcccgatgatcgaggacatgaaggacatcgccgtggcc
gcatactatggcgtgccgcaggccgaaggccacaagattcgcgttgagcgtgagggcgtg
gccgccaccgaagaggcgtccgagcgcgtctga

DBGET integrated database retrieval system