KEGG   Blattabacterium sp. (Blatta orientalis): BLBBOR_420Help
Entry
BLBBOR_420        CDS       T02446                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbq  Blattabacterium sp. (Blatta orientalis)
Pathway
bbq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbq01100  Metabolic pathways
bbq01110  Biosynthesis of secondary metabolites
bbq01130  Biosynthesis of antibiotics
bbq01230  Biosynthesis of amino acids
Module
bbq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBOR_420
Enzymes [BR:bbq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BLBBOR_420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AGD98301
UniProt: L7Y7B0
Position
422084..422893
Genome map
AA seq 269 aa AA seqDB search
MNILDKIISVKQKEVSKNRILYPIQKLEKSILFNRKSLSLVRSIEKSFAGIIAEFKRKSP
SKGIINDTISMEKVVKDYEKAGASGISILTDYSFFSGKNENLTKTRSIVSIPLLRKDFII
DEYQIIESKSIGSDVILLIAEILSKKKIKDFASLAKSINLEVIIEIHCEKEIEKLTENSD
IIGINNRNLRTFLVDFKNCSKLVSKIPKNYMKMAESGITDVESILHLRKKGFQGFLIGEN
FMKDKDPGKSCRNMINALKSHENKNHNEI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgataaaattatttctgtaaagcaaaaagaagtatccaaaaataggatc
ctctatcccatacaaaaactggaaaagagtattctatttaatagaaaatctctttcttta
gttaggagtatagaaaaaagtttcgctggaattattgcagaatttaagcgtaagtctcct
tctaaaggaataatcaatgatacaatatccatggaaaaagtggtcaaagattatgaaaaa
gctggtgctagtggaatatctattcttacagattattcctttttttctggaaaaaatgaa
aacttaacaaaaacacgttcaattgtttctattcctttattaagaaaggattttattatt
gatgaatatcaaattatagaatcaaaatctataggatctgatgttattttattgatagca
gaaattctctctaagaaaaaaattaaagattttgcttctttagcaaagagtatcaattta
gaagtgattatagaaatacactgtgaaaaagaaatagaaaaattgacagaaaattcagat
atcataggaattaacaatcgaaatttacgaacctttcttgtagatttcaaaaattgttca
aaattagtttcaaaaattcctaaaaattatatgaaaatggcagaaagtggaattacagat
gttgaaagtattctgcatttacgaaaaaaaggatttcaaggttttttaattggagaaaat
ttcatgaaagataaagatcctggaaagagttgtagaaatatgattaatgcattaaaaagt
cacgaaaataaaaatcacaatgaaatttag

DBGET integrated database retrieval system