KEGG   Blattabacterium sp. (Blatta orientalis): BLBBOR_566Help
Entry
BLBBOR_566        CDS       T02446                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbq  Blattabacterium sp. (Blatta orientalis)
Pathway
bbq00790  Folate biosynthesis
bbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLBBOR_566
Enzymes [BR:bbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BLBBOR_566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF CryBP1
Motif
Other DBs
NCBI-ProteinID: AGD98440
UniProt: L7YCT0
Position
complement(570523..571200)
Genome map
AA seq 225 aa AA seqDB search
MGEEYKKFLEKDNKDTNFLENHETPIRDDAFLISDEKKIDKIEKHFFHIMEILGLDMNDD
SLRSTPKRVAKMFIKEIFSGLNPKNHPHLSTFENKYKYNQMLIEKNIIVYSTCEHHFLPI
VGKAHVGYISNGKVVGLSKINRIVNFYAKRPQVQERLTMQIVKSLQKILDTKNVACVIDA
KHLCVNSRGIRDIDTRTITTELVGAFKKIRNSKRIFPLYWKILIL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagagtataaaaaatttttagaaaaagataataaggatactaattttttagaa
aatcatgaaactccaatacgtgatgatgcttttcttataagcgatgaaaaaaaaattgat
aaaatagaaaaacattttttccacattatggaaattttaggtttggatatgaatgatgat
agtttacgcagtacacctaaacgtgtagcaaaaatgtttataaaagaaatatttagcgga
ctaaatccaaaaaatcatcctcatttatccacttttgaaaataaatataaatataatcag
atgttgatagaaaaaaacataatagtttattctacttgtgagcatcattttctacctatt
gttggaaaagcacatgttggctacatttccaatggaaaggtagtgggtctttctaaaatc
aatagaatcgtaaatttttacgcaaaaagaccacaagttcaagaacgtttgactatgcaa
attgttaaatctttacaaaaaatactagatacaaaaaatgttgcttgtgttatagacgca
aaacatttatgtgtaaattctcgtggaattcgagatatagataccagaacgatcactact
gaattagtaggagcatttaaaaagattcggaattcgaagagaatttttccattatattgg
aagatcctaattttatga

DBGET integrated database retrieval system