KEGG   Bordetella bronchiseptica RB50: BB0311Help
Entry
BB0311            CDS       T00141                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00330  Arginine and proline metabolism
bbr00332  Carbapenem biosynthesis
bbr01100  Metabolic pathways
bbr01130  Biosynthesis of antibiotics
bbr01230  Biosynthesis of amino acids
Module
bbr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BB0311 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BB0311 (proB)
Enzymes [BR:bbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BB0311 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAE30809
GeneDB: BB0311
UniProt: Q7WQL9
Position
complement(315353..316489)
Genome map
AA seq 378 aa AA seqDB search
MTAQTSAVSVISAANRLVAKVGSSLVTNEGRGLDRAAVGHWAAQIAALHQQGKQVVLVSS
GAIAEGMARLGWRKRPSAMHELQAAAAVGQMGLCQAYEAAFAEFGLRTAQILLTHEDLAD
RHRYLNARSTLFALLRLGVVPIVNENDTVVTDEIRFGDNDTLGALVTNLIEADALIILTD
QRGLYEADPRRDPAARFVAHAQAGDAALEAMAGGAGSGVGTGGMLTKILAAKRAAHSGAH
TVIASGRERNVLTRLAQGECIGTELRAVLPVWSARKQWLADHLRLRGRVVLDDGAVHALL
HEGKSLLPIGVAEVQGEFERGDVVACVDMHGRECARGLINYSSADTRRILRQPSSQIARI
LGSMTDPELMHRDNLVVT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaaacctctgccgtttctgtcatttccgcggccaatcggctggtcgccaaa
gtgggttcctcgctggtcaccaacgaaggccggggcctcgatcgcgccgcggtaggccac
tgggcagcccagatcgccgccctgcaccagcagggcaagcaggtcgtgctggtttccagc
ggcgccattgccgaaggcatggcgcggctgggctggcgcaagcgcccttcggccatgcac
gaattgcaggccgccgccgccgtgggccagatgggcctgtgccaggcttacgaagccgcc
ttcgccgagttcggcctgcgcaccgcgcagatcctgctcacccacgaagacctggccgac
cggcaccgctacctgaatgcgcgctcgaccctgttcgccctgctgcgcctgggcgtggtg
cccatcgtcaacgaaaacgacaccgtcgtcaccgacgaaatccgcttcggcgacaatgac
accctgggcgccctggtcaccaacctgatcgaagccgatgcgctcatcatcctgaccgac
cagcgcggcctgtacgaagccgacccgcgccgcgacccggccgcgcgcttcgtggcgcat
gcgcaagccggcgatgccgccctggaagccatggccggcggcgccggcagcggcgtgggc
accggcggcatgctcaccaagatcctggcggccaagcgggccgcccacagcggcgcccat
accgtcatcgcatcaggccgcgaacgcaatgtgctgacccgcctggcgcaaggcgaatgc
atcggcacggaattgcgcgcggtcctgccggtatggtcggcgcgcaagcaatggctggcc
gaccacctgcgcctgcgcggccgcgtggtgctcgatgatggcgccgtgcatgccctgctg
cacgagggcaagagcctgctgcccatcggcgtggccgaagtccagggcgagttcgagcgc
ggcgacgtcgtggcctgcgtcgacatgcatggacgcgagtgcgcgcgcggcctgatcaat
tattcgtcggccgatacccggcgcatcctgcgccagccgtcgagccagatcgcgcgcatc
ctgggcagcatgacagacccggaactgatgcaccgcgacaacctggtcgtcacctga

DBGET integrated database retrieval system