KEGG   Bordetella bronchiseptica RB50: BB0800
Entry
BB0800            CDS       T00141                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bbr  Bordetella bronchiseptica RB50
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbr02044]
    BB0800
Secretion system [BR:bbr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BB0800
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAE31299
GeneDB: BB0800
UniProt: A0A0H3LN18
Position
840607..841170
AA seq 187 aa
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVG
ERKFLDVDIDNFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGA
LNEMLEARTQLANLLTYMDGKTGAEELIGQVLQNPALLGALAAAPKPADAGPADADAESA
QPGPQAR
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcaaccacgctcaaaggcagcggccagaaattcatcgccaggaatcgcgcgccgcgc
gtgcagatcgagtacgacgtggagatctacggcgccgagcgcaagatccagctgcccttc
gtcatgggcgtgctggccgacctggccggcaagtcgaacacgccgcagcccgaagtgggc
gagcgcaagttcctcgacgtagatatcgacaatttcgacgagcgcatgaagtcggtcgcc
ccgcgggccgcgttccaggtggccaatacgctgaccggcgccggccatctgaacgtggac
atcaccttcgagagcatcgacgatttttccccggccaccgtggcgcgcaaggtgggcgcg
ctcaacgagatgctggaggcccgcacgcagctggccaacctgctgacctacatggacggc
aagaccggcgccgaggagctgatcggccaggtgctgcagaacccggccctgctgggcgcg
ctggcggccgcgcccaagcccgccgacgccgggccggccgatgccgacgccgagagcgcg
cagcccggcccgcaagcccgataa

DBGET integrated database retrieval system