KEGG   Bordetella bronchiseptica RB50: BB1795Help
Entry
BB1795            CDS       T00141                                 

Definition
(GenBank) Putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00071  Fatty acid degradation
bbr00072  Synthesis and degradation of ketone bodies
bbr00280  Valine, leucine and isoleucine degradation
bbr00310  Lysine degradation
bbr00362  Benzoate degradation
bbr00380  Tryptophan metabolism
bbr00620  Pyruvate metabolism
bbr00630  Glyoxylate and dicarboxylate metabolism
bbr00640  Propanoate metabolism
bbr00650  Butanoate metabolism
bbr00900  Terpenoid backbone biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
bbr01212  Fatty acid metabolism
bbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB1795
   00630 Glyoxylate and dicarboxylate metabolism
    BB1795
   00640 Propanoate metabolism
    BB1795
   00650 Butanoate metabolism
    BB1795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB1795
   00072 Synthesis and degradation of ketone bodies
    BB1795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB1795
   00310 Lysine degradation
    BB1795
   00380 Tryptophan metabolism
    BB1795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BB1795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB1795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BB1795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbr04147]
    BB1795
Enzymes [BR:bbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BB1795
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BB1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAE32292
GeneDB: BB1795
UniProt: A0A0H3LLT1
Position
complement(1891030..1892322)
Genome map
AA seq 430 aa AA seqDB search
MRFQPVYIVDGTRSPFLKARNGPGPFSAADLAVQAGRALLLRQPFAPTDLDEVIVGCAAP
SPDEVNIGRVIALRLGCGNRVPGWTVMRNCASGMQALDSAIANLQLGRSSLVLAGGTDAL
SRAPLLFSDDMVKWLARWYGARGLGARLRALGALRLRYLAPVIGLLKGLTDPVVGLSMGQ
TAENLATRFGIDRAAMDAYAARSHLRVLAAREAGRLGEIVPLADTRGAVYPDDDGVRDDS
TPQRLARLRPAFDKPWGNITAGNSSQVTDGAAMLLLASEAAVRKWGLRPLGRILDSQWAG
LDPAQMGLGPVHAATPIMQRHGLGLHDLDLWEINEAFAAQVLACLAAWDDEAYCREHFGT
GAWGRLDQDRLNVDGGAIALGHPVGASGARIVLHLLQALKARGMRHGMAAICIGGGQGGA
MLVENLEERA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcaaccggtatacatcgtcgacggcacgcgcagccccttcctgaaggcgcgc
aacggccccggaccgttctcggccgccgacctggccgtgcaggccggccgcgcgctgctg
ctgcgccagcctttcgcccccaccgacctggacgaagtcatcgtcggctgcgcggcgccc
tcgcccgacgaagtcaatatcggccgcgtcatcgccctgcggctgggctgcggcaaccgc
gtgcccgggtggacggtgatgcgcaattgcgcctccggcatgcaggccctcgattcggcc
atcgccaatctgcagctgggccgcagcagcctggtgctggccggcggcaccgacgcgctg
tcgcgcgcgccgctgctgttctccgacgacatggtcaagtggctggcgcgctggtatggc
gcgcgcggcctgggcgcccggctgcgcgcgctgggcgcgctgcgcctgcgctacctggcg
ccggtcatcggcctgctcaagggcctgaccgatccggtggtgggcctgtcgatgggacag
acggccgagaacctggccacccgcttcggcatcgaccgcgccgccatggacgcctacgcg
gcgcgcagccacctgcgcgtgctggccgcgcgcgaagccggccggctgggcgagatcgtg
ccgctggccgatacgcgcggcgccgtctaccccgacgacgatggcgtgcgcgacgactcc
accccgcaacgcctggcgcgcctgcgcccggcgttcgacaagccgtggggcaacatcacg
gccggcaacagctcgcaggtcaccgacggcgcggccatgctgctgctggcttcggaggcc
gcggtccgcaaatgggggctgcgcccgctggggcgcatcctcgacagccagtgggccggc
ctggatccggcccagatgggcctggggccggtgcacgcggccacgcccatcatgcagcgg
catggactgggcctgcacgacctggacctgtgggaaatcaacgaagccttcgccgcgcag
gtgctggcctgcctggcggcctgggacgacgaggcctattgccgcgaacacttcggcacc
ggggcctggggccgcctggaccaggaccgcctgaacgtggacggcggcgccatcgcgctg
ggccatccggtgggcgcctcgggcgcgcgcatcgtgctgcacctgctgcaggccctgaag
gcgcgcggcatgcgccacggcatggccgccatctgcatcggcggcggccagggcggggcc
atgctggtcgaaaacctcgaggagcgcgcatga

DBGET integrated database retrieval system